FC931429

Overview
NameFC931429
Unique NameFC931429
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length713
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15323 contig Ccv1_Contig15323:1..713. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: AB30G_ARATH (ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2)

HSP 1 Score: 145.591 bits (366), Expect = 2.491e-34
Identity = 73/195 (37.44%), Postives = 114/195 (58.46%), Query Frame = 2
Query:   29 QDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKMDTGE--TVKQFLKDYFDFKHD 607
            QDL +  G M+T V+F G+  C++V   ++ ER VFYRE+ A MY+   ++ +QV+IE+PY L+QS++   IVY  IG+  +  K FW +               + VALTPN H+A  + + F+ + N+F+GFV             Y+ +P +W L GL++SQ+GD+D + +  GE   V  FL+DYF +KH+
Sbjct: 1174 QDLISIFGSMYTLVVFPGMNNCAAVINFIAAERNVFYRERFARMYSSWAYSFSQVLIEVPYSLLQSLLCTIIVYPTIGYHMSVYKMFWSLYSIFCSLLIFNYSGMLMVALTPNIHMAVTLRSSFFSMLNLFAGFVIPKQKIPKWWIWMYYLSPTSWVLEGLLSSQYGDVDKEILVFGEKKRVSAFLEDYFGYKHE 1368          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: ABCGJ_DICDI (ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 3.166e-13
Identity = 41/174 (23.56%), Postives = 78/174 (44.83%), Query Frame = 2
Query:   35 LFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKMDT 556
            LF   G +F+ +LF  +  C    P+   +R +  ++ +  MY      +AQ++ +IP  ++Q  ++  +VY M G ++ A KFF +                M    +P+ +I+  V  +F      ++G+             +YW NP ++    L+A++FGD+     DT
Sbjct:  522 LFTRGGTLFSVILFNAL-LCECEMPLTFGQRGILQKQHSYAMYRPSALHIAQIVTDIPLTIIQVFLFSIVVYFMFGLQYDAGKFFIFCFTLVGATLATTNLFRMFGNFSPSLYISQNVMNIFIISMITYTGYTIPKPKMHPWFSWFYWCNPFSYAFKALMANEFGDLSFDCQDT 694          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: ABCGL_DICDI (ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.018e-11
Identity = 41/175 (23.43%), Postives = 79/175 (45.14%), Query Frame = 2
Query:   35 LFNAMGPMFTAVLFLGVQYCSSVQ-PIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKMDT 556
            LF   G +F+A+LF    + S  + P+    R +  ++++  MY      +AQ++ +IP  ++Q  ++  +VY M G ++ A KFF +                +    +P+ +I+  V  +       + G+             +YWANP ++    L+A++FGD+     DT
Sbjct:  522 LFTRGGAIFSAILFNA--FLSEAELPLTMYGRRILQKQRSYAMYRPSALHIAQIVTDIPLTMIQVFLFSIVVYFMFGLQYNAGKFFIFCFTLVGATLATTNLFRVFGNFSPSLYISQNVMNVILIFMITYCGYTIPKPKMHPWFAWFYWANPFSYAFKALMANEFGDLSFDCHDT 694          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: ABCG2_DICDI (ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 2.963e-11
Identity = 41/161 (25.47%), Postives = 76/161 (47.20%), Query Frame = 2
Query:   41 NAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQ 523
            N  G +F ++LF+      ++  I+  +R VFY +K    Y    + L+ +  EIP  L+++VV+  +VY M G +  A KF +++               M  A  PN  +A++++      + +FSGF+             YW +PI +   GL++++
Sbjct:  424 NRSGLIFFSLLFIVFSGMGAIA-ILFEQREVFYIQKDGKYYKTFAFFLSLIFSEIPIALLETVVFCVLVYWMCGLQANAEKFIYFLLMNFVGDLAFQSFFKMVSAFAPNATLASVIAPAALAPFILFSGFMAPKRSIGGWWIWIYWISPIKYAFEGLMSNE 583          

HSP 2 Score: 67.781 bits (164), Expect = 6.601e-11
Identity = 38/172 (22.09%), Postives = 88/172 (51.16%), Query Frame = 2
Query:   29 QDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIG--FEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMD 538
            ++++N +  +F +++F G+   SS+ PIV++ER VFYRE+A+GMY+   +    ++ ++P++ + +++Y   +Y + G   +   A FF++                +   + P   IA  +  +   + ++F+GF+            +Y  +P  + L  ++ ++F D++
Sbjct: 1081 ENIYNRVSILFFSLMFGGMSGMSSI-PIVNMERGVFYREQASGMYSIPIYLFTFIVTDLPWVFLSAIIYTVPMYFISGLRLDPNGAPFFYHSFISFTTYFNFSMLAMVFATVLPTDEIAHALGGVALSISSLFAGFMIPPASIAKGWHWFYQLDPTTYPLAIVMINEFQDLE 1251          
The following BLAST results are available for this feature:
BLAST of FC931429 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 34
Match NameE-valueIdentityDescription
AB30G_ARATH2.491e-3437.44ABC transporter G family member 30 OS=Arabidopsis ... [more]
ABCGJ_DICDI3.166e-1323.56ABC transporter G family member 19 OS=Dictyosteliu... [more]
ABCGL_DICDI1.018e-1123.43ABC transporter G family member 21 OS=Dictyosteliu... [more]
ABCG2_DICDI2.963e-1125.47ABC transporter G family member 2 OS=Dictyostelium... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34105A06EF PostHarvP1 Citrus clementina cDNA clone C34105A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931429 ID=FC931429|Name=FC931429|organism=Citrus clementina|type=EST|length=713bp
GGACCTGGGTGGTAGAACGAAAAGGAACCAAGATCTTTTCAATGCAATGG
GTCCCATGTTTACTGCAGTTCTCTTCCTTGGTGTTCAATATTGTTCGTCA
GTGCAGCCAATAGTATCAGTTGAAAGGACAGTCTTTTACAGGGAAAAAGC
TGCCGGCATGTATGCAGGCATACCATGGGCATTAGCACAAGTTATGATTG
AGATTCCTTATATATTAGTTCAGTCAGTAGTGTATGGTGCTATAGTCTAT
GCTATGATTGGATTTGAATGGACAGCCGCCAAGTTTTTTTGGTATATATT
CTTCATGTACTTCACATTATTGTTCTTCACCTTCTATGGCATGATGGCTG
TGGCTTTGACACCAAACCACCACATCGCTGCCATTGTTTCAACTTTATTT
TATGGATTGTGGAACGTCTTTTCTGGGTTTGTTATCCCAAGACCTAGGAT
TCCAATATGGTGGAGATGGTACTATTGGGCCAACCCCATAGCTTGGACCT
TGTATGGACTGGTTGCTTCGCAGTTCGGAGATATGGACGACAAGAAAATG
GATACTGGTGAAACGGTGAAACAGTTTCTTAAGGACTATTTTGATTTCAA
ACATGATTTTCTGGGAGTAGTTGCAGCTGTTCTCGTTGTCTTTGCAGTGT
TATTTGGATTTCTCTTCGCCCTAGGAATTAAGATGTTTAACTTCCAGAAG
CGGTAGTAATTCT
back to top