FC931458

Overview
NameFC931458
Unique NameFC931458
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length640
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC931458_ssr5 microsatellite FC931458_ssr5:5..16. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig15332 contig Ccv1_Contig15332:1..640. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_STAAW (Cysteine synthase OS=Staphylococcus aureus (strain MW2) GN=cysK PE=3 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 6.211e-31
Identity = 68/126 (53.97%), Postives = 92/126 (73.02%), Query Frame = 2
Query:  263 DVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            ++T++IG TP+V L  +VD   A +  KLE   P  SVKDRI  +MI  AE +G I+PG+++ +EPTSGNTGIGLAF+ AAKGY+ + TMP +MS ERR +L A+GAELVLT  +  MK A++KA+
Sbjct:    8 NITQIIGGTPVVKLRNVVDDNAADVYVKLEYQNPGGSVKDRIALAMIEKAEREGKIKPGDTI-VEPTSGNTGIGLAFVCAAKGYKAVFTMPETMSQERRNLLKAYGAELVLTPGSEAMKGAIKKAK 132          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_STAAS (Cysteine synthase OS=Staphylococcus aureus (strain MSSA476) GN=cysK PE=3 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 6.211e-31
Identity = 68/126 (53.97%), Postives = 92/126 (73.02%), Query Frame = 2
Query:  263 DVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            ++T++IG TP+V L  +VD   A +  KLE   P  SVKDRI  +MI  AE +G I+PG+++ +EPTSGNTGIGLAF+ AAKGY+ + TMP +MS ERR +L A+GAELVLT  +  MK A++KA+
Sbjct:    8 NITQIIGGTPVVKLRNVVDDNAADVYVKLEYQNPGGSVKDRIALAMIEKAEREGKIKPGDTI-VEPTSGNTGIGLAFVCAAKGYKAVFTMPETMSQERRNLLKAYGAELVLTPGSEAMKGAIKKAK 132          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_STAAR (Cysteine synthase OS=Staphylococcus aureus (strain MRSA252) GN=cysK PE=3 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 6.211e-31
Identity = 68/126 (53.97%), Postives = 92/126 (73.02%), Query Frame = 2
Query:  263 DVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            ++T++IG TP+V L  +VD   A +  KLE   P  SVKDRI  +MI  AE +G I+PG+++ +EPTSGNTGIGLAF+ AAKGY+ + TMP +MS ERR +L A+GAELVLT  +  MK A++KA+
Sbjct:    8 NITQIIGGTPVVKLRNVVDDNAADVYVKLEYQNPGGSVKDRIALAMIEKAEREGKIKPGDTI-VEPTSGNTGIGLAFVCAAKGYKAVFTMPETMSQERRNLLKAYGAELVLTPGSEAMKGAIKKAK 132          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_STAAN (Cysteine synthase OS=Staphylococcus aureus (strain N315) GN=cysK PE=1 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 6.211e-31
Identity = 68/126 (53.97%), Postives = 92/126 (73.02%), Query Frame = 2
Query:  263 DVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            ++T++IG TP+V L  +VD   A +  KLE   P  SVKDRI  +MI  AE +G I+PG+++ +EPTSGNTGIGLAF+ AAKGY+ + TMP +MS ERR +L A+GAELVLT  +  MK A++KA+
Sbjct:    8 NITQIIGGTPVVKLRNVVDDNAADVYVKLEYQNPGGSVKDRIALAMIEKAEREGKIKPGDTI-VEPTSGNTGIGLAFVCAAKGYKAVFTMPETMSQERRNLLKAYGAELVLTPGSEAMKGAIKKAK 132          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_STAAM (Cysteine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cysK PE=1 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 6.211e-31
Identity = 68/126 (53.97%), Postives = 92/126 (73.02%), Query Frame = 2
Query:  263 DVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            ++T++IG TP+V L  +VD   A +  KLE   P  SVKDRI  +MI  AE +G I+PG+++ +EPTSGNTGIGLAF+ AAKGY+ + TMP +MS ERR +L A+GAELVLT  +  MK A++KA+
Sbjct:    8 NITQIIGGTPVVKLRNVVDDNAADVYVKLEYQNPGGSVKDRIALAMIEKAEREGKIKPGDTI-VEPTSGNTGIGLAFVCAAKGYKAVFTMPETMSQERRNLLKAYGAELVLTPGSEAMKGAIKKAK 132          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_STAAC (Cysteine synthase OS=Staphylococcus aureus (strain COL) GN=cysK PE=3 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 6.211e-31
Identity = 68/126 (53.97%), Postives = 92/126 (73.02%), Query Frame = 2
Query:  263 DVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            ++T++IG TP+V L  +VD   A +  KLE   P  SVKDRI  +MI  AE +G I+PG+++ +EPTSGNTGIGLAF+ AAKGY+ + TMP +MS ERR +L A+GAELVLT  +  MK A++KA+
Sbjct:    8 NITQIIGGTPVVKLRNVVDDNAADVYVKLEYQNPGGSVKDRIALAMIEKAEREGKIKPGDTI-VEPTSGNTGIGLAFVCAAKGYKAVFTMPETMSQERRNLLKAYGAELVLTPGSEAMKGAIKKAK 132          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSM_BACSU (Probable cysteine synthase OS=Bacillus subtilis GN=ytkP PE=3 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 1.691e-28
Identity = 67/129 (51.94%), Postives = 89/129 (68.99%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            I  +  +LIG TPLV LNR+     A++  KLE   P  SVKDR  Y MI +AE+ GL++PG SV+IEPTSGNTGIGLA  AAA+GY+ I+ MP +M+ ER  +L A+GAE+VLT     M  +++KA+
Sbjct:    4 IVANTADLIGDTPLVRLNRLQPENAAQVYLKLEFFNPSGSVKDRAAYQMIIEAEQNGLLKPG-SVIIEPTSGNTGIGLAMNAAARGYKAILVMPDTMTKERINLLKAYGAEVVLTPGEERMPGSIKKAK 131          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_FLAS3 (Cysteine synthase OS=Flavobacterium sp. (strain K3-15 / DSM ID92-509) GN=cysK PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 3.768e-28
Identity = 67/126 (53.17%), Postives = 88/126 (69.84%), Query Frame = 2
Query:  260 KDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKA 637
            ++  E IG TP+V +N + +     I  KLE   P  S+KDRI  +MI DAE KGL+   +S +IEPTSGNTGIGLA +AA KGY+LI+ MP SMS+ERR ++ A+GAE VLT   +GMK A++KA
Sbjct:    4 QNALETIGNTPVVKINNLFNSD-HEIWIKLEKSNPGGSIKDRIALAMIEDAEAKGLLNK-DSTIIEPTSGNTGIGLALVAAVKGYKLILVMPESMSIERRKIMEAYGAEFVLTPREKGMKGAIEKA 127          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CBS_YEAST (Cystathionine beta-synthase OS=Saccharomyces cerevisiae GN=CYS4 PE=1 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.134e-24
Identity = 61/117 (52.14%), Postives = 77/117 (65.81%), Query Frame = 2
Query:  263 DVTELIGKTPLVYLNRIVD--GCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPA 607
            +V +L+G TPL+ L ++    G   +I AKLE+  P  S+KDRI  SM+ +AE  G I P  S LIEPTSGNTGIGLA + A KGYR IIT+P  MS E+  VL A GAE++ T  A
Sbjct:   13 NVIDLVGNTPLIALKKLPKALGIKPQIYAKLELYNPGGSIKDRIAKSMVEEAEASGRIHPSRSTLIEPTSGNTGIGLALIGAIKGYRTIITLPEKMSNEKVSVLKALGAEIIRTPTA 129          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_BUCAI (Cysteine synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum GN=cysK PE=3 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 2.527e-24
Identity = 67/130 (51.54%), Postives = 85/130 (65.38%), Query Frame = 2
Query:  248 SVIAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKA 637
            S I +D +  IG TPLV LNRI +G    I  K+E   P  SVK RIG +MI  AE+   I      LIE TSGNTGI LA++AA++ YRL +TMP +MS+ER+ +L + GAEL+LTD   GMK A+ KA
Sbjct:    2 SKIYQDNSLTIGNTPLVRLNRIGNG---NILVKIESRNPSFSVKCRIGANMIWHAEKNNNINKNVK-LIEATSGNTGIALAYVAASRNYRLTLTMPETMSIERKKILKSLGAELILTDGRYGMKGAISKA 127          
The following BLAST results are available for this feature:
BLAST of FC931458 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 64
Match NameE-valueIdentityDescription
CYSK_STAAW6.211e-3153.97Cysteine synthase OS=Staphylococcus aureus (strain... [more]
CYSK_STAAS6.211e-3153.97Cysteine synthase OS=Staphylococcus aureus (strain... [more]
CYSK_STAAR6.211e-3153.97Cysteine synthase OS=Staphylococcus aureus (strain... [more]
CYSK_STAAN6.211e-3153.97Cysteine synthase OS=Staphylococcus aureus (strain... [more]
CYSK_STAAM6.211e-3153.97Cysteine synthase OS=Staphylococcus aureus (strain... [more]
CYSK_STAAC6.211e-3153.97Cysteine synthase OS=Staphylococcus aureus (strain... [more]
CYSM_BACSU1.691e-2851.94Probable cysteine synthase OS=Bacillus subtilis GN... [more]
CYSK_FLAS33.768e-2853.17Cysteine synthase OS=Flavobacterium sp. (strain K3... [more]
CBS_YEAST1.134e-2452.14Cystathionine beta-synthase OS=Saccharomyces cerev... [more]
CYSK_BUCAI2.527e-2451.54Cysteine synthase OS=Buchnera aphidicola subsp. Ac... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34105C12EF PostHarvP1 Citrus clementina cDNA clone C34105C12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931458 ID=FC931458|Name=FC931458|organism=Citrus clementina|type=EST|length=640bp
GATGTTTATTTATTTATTCATTTTTATTTTTTGTTTTGTTCTATATTTCT
CATTTGGCCGCCTGAAGAATATTTATATAAGCAAAATCATCGTAACGCAT
AAACATAATTATTATCGGGAGATTTATTTGTTTTTCAATTTTCTACTGTT
TTCCAGCTGCCTTGACATTGTTTACGATTCTTCCCAGAGAAAGCTTTCGC
GTTCGCTTGTAACTTGAAAAAAAGAAAAAAAAATGGTGGAGGAGAAGTCC
GTGATTGCGAAAGATGTCACTGAATTGATTGGTAAAACACCATTGGTGTA
TCTCAACCGCATTGTGGATGGTTGCGTTGCTAGAATTGCTGCCAAGCTGG
AGATGATGGAACCCTGCTCTAGCGTCAAAGATAGAATTGGATACAGTATG
ATCGCTGATGCAGAGGAGAAGGGTCTCATTAGACCAGGCGAGAGTGTCCT
GATTGAGCCTACCAGCGGTAATACTGGCATAGGGTTGGCATTCATGGCAG
CTGCTAAGGGTTACAGACTTATAATTACCATGCCTGCTTCAATGAGTCTT
GAAAGAAGAATGGTTCTCCTAGCTTTTGGAGCTGAGCTTGTGCTCACTGA
TCCTGCCAGGGGCATGAAGAGAGCTGTTCAGAAGGCAGAA
back to top