FC931458

Overview
NameFC931458
Unique NameFC931458
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length640
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC931458_ssr5 microsatellite FC931458_ssr5:5..16. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig15332 contig Ccv1_Contig15332:1..640. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSM_PSEAE (Cysteine synthase B OS=Pseudomonas aeruginosa GN=cysM PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 5.270e-22
Identity = 58/125 (46.40%), Postives = 77/125 (61.60%), Query Frame = 2
Query:  266 VTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            + + +G TPLV L R+       +  KLE   P  SVKDR   SMI  AE +G IRPG++ LIE TSGNTGI LA  AA KGY++I+ MP + + ER+  + A+GAEL+L     GM+ A   A+
Sbjct:    8 IADCVGNTPLVRLQRLPGETSNTLLVKLEGNNPAGSVKDRPALSMITRAELRGDIRPGDT-LIEATSGNTGIALAMAAAIKGYKMILIMPDNSTAERKAAMTAYGAELILVSKEEGMEGARDLAD 131          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSM_PSESY (Cysteine synthase B (Fragment) OS=Pseudomonas syringae pv. syringae GN=cysM PE=3 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 6.883e-22
Identity = 59/125 (47.20%), Postives = 75/125 (60.00%), Query Frame = 2
Query:  266 VTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            + + +G TPLV L R+       +  KLE   P  SVKDR   SMI  AE +G I PG++ LIE TSGNTGI LA  AA KGYR+I+ MP + S ER+  + A+GAEL+      GM+ A   AE
Sbjct:    8 IADCVGNTPLVRLQRMAGNTSNTLLLKLEGNNPAGSVKDRPALSMITRAELRGQIHPGDT-LIEATSGNTGIALAMAAAIKGYRMILIMPDNSSAERKAAMTAYGAELISVSKDDGMEGARDLAE 131          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: MCCA_BACSU (O-acetylserine dependent cystathionine beta-synthase OS=Bacillus subtilis GN=mccA PE=1 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.533e-21
Identity = 56/128 (43.75%), Postives = 78/128 (60.94%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKA 637
            +  D+TELIG TPL+ L          + AKLEMM P  S+KDR+G  +I DA + G ++PG  V+IE T+GNTGIGLA  A   G + I  +P   S E++ ++ A GA ++ T    GM+ A+QKA
Sbjct:    3 VITDITELIGNTPLLRLKNFDVPEGVAVYAKLEMMNPGGSIKDRLGDMLIRDALDSGKVKPG-GVIIEATAGNTGIGLALSARKYGLKAIFCVPEHFSREKQQIMQALGASIIHTPRQDGMQGAIQKA 129          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSM_MYCTU (Cysteine synthase B OS=Mycobacterium tuberculosis GN=cysM PE=1 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.002e-21
Identity = 60/130 (46.15%), Postives = 77/130 (59.23%), Query Frame = 2
Query:  272 ELIGKTPLVYLNRIV-------DGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            + +G TPLV L R+        DG   R+ AKLE   P  S+KDR    MI  AE  GL+RPG ++L EPTSGNTGI LA  A  KGYRLI  MP + S+ERR +L  +GA+++ +    G   AV  A+
Sbjct:    9 QALGNTPLVGLQRLSPRWDDGRDGPHVRLWAKLEDRNPTGSIKDRPAVRMIEQAEADGLLRPGATIL-EPTSGNTGISLAMAARLKGYRLICVMPENTSVERRQLLELYGAQIIFSAAEGGSNTAVATAK 137          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSM_MYCBO (Cysteine synthase B OS=Mycobacterium bovis GN=cysM PE=3 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.002e-21
Identity = 60/130 (46.15%), Postives = 77/130 (59.23%), Query Frame = 2
Query:  272 ELIGKTPLVYLNRIV-------DGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            + +G TPLV L R+        DG   R+ AKLE   P  S+KDR    MI  AE  GL+RPG ++L EPTSGNTGI LA  A  KGYRLI  MP + S+ERR +L  +GA+++ +    G   AV  A+
Sbjct:    9 QALGNTPLVGLQRLSPRWDDGRDGPHVRLWAKLEDRNPTGSIKDRPAVRMIEQAEADGLLRPGATIL-EPTSGNTGISLAMAARLKGYRLICVMPENTSVERRQLLELYGAQIIFSAAEGGSNTAVATAK 137          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSM_CAMJE (Cysteine synthase B OS=Campylobacter jejuni GN=cysM PE=3 SV=2)

HSP 1 Score: 98.2117 bits (243), Expect = 3.777e-20
Identity = 56/128 (43.75%), Postives = 76/128 (59.38%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKA 637
            + + V+ELIG TP+++L +        + AK E + P  S+KDR  + MI DA +   I   ++ ++E TSGNTGI LA + A  G + I  MP SMSLERR ++  FGA L LT    GMK AV KA
Sbjct:    3 VHEKVSELIGNTPIIHLKKFG----INVFAKCEFLNPSHSIKDRAAFEMIKDALDSKKINQ-DTTIVEATSGNTGISLAMICADLGLKFIAVMPESMSLERRKMITLFGARLELTPANLGMKGAVDKA 125          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSM_AQUAE (Cysteine synthase OS=Aquifex aeolicus GN=cysM PE=3 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 6.442e-20
Identity = 56/124 (45.16%), Postives = 79/124 (63.71%), Query Frame = 2
Query:  266 VTELIGKTPLVYLNRIVDGCV---ARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAV 628
            + +L+G TPLV + + +   +     I AKLE   P  SVKDR   SM  DA ++GLI+ G+ V+I+ TSGNTGI LA + AA G  + + MPA++S ER+ ++ AFGA+L LTDP  G   A+
Sbjct:   25 ILKLVGNTPLVRVKKCLPEDIPEDVEIWAKLESFNPGGSVKDRPALSMFLDALKRGLIKEGK-VVIDATSGNTGIALAMVGAALGVPVELAMPANVSEERKKIIKAFGAKLYLTDPLEGTDGAI 147          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_EMENI (Cysteine synthase OS=Emericella nidulans GN=cysB PE=3 SV=2)

HSP 1 Score: 94.3597 bits (233), Expect = 5.453e-19
Identity = 50/108 (46.30%), Postives = 71/108 (65.74%), Query Frame = 2
Query:  266 VTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAEL 589
            +TE IG TPL+ L R+ +   + I AK E   P  SVKDR    ++ DAEE+GL++PG +V +E T+GNTGIGLA +  +KGY+L+I MP + S  +  +L   GAE+
Sbjct:   36 LTEAIGNTPLIRLKRLSEETGSNILAKAEFQNPGGSVKDRAALYVVKDAEERGLLKPGGTV-VEGTAGNTGIGLAHVCRSKGYKLVIYMPNTQSQGKIDLLRLLGAEV 142          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK1_SCHPO (Cysteine synthase 1 OS=Schizosaccharomyces pombe GN=cys11 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 3.308e-16
Identity = 46/104 (44.23%), Postives = 64/104 (61.54%), Query Frame = 2
Query:  278 IGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAEL 589
            IG+TPL+ LN + +     I AK E   P  SVKDR  Y ++ DAE+KG +  G   ++E T+GNTGIGLA +A A+GY+ +I MP + S  +   L   GAE+
Sbjct:   21 IGRTPLIRLNTLSNETGCNILAKAEFQNPGGSVKDRAAYYVVRDAEKKGKLSRG-GTIVEGTAGNTGIGLAHIARARGYKCVIYMPNTQSQAKIDTLKFLGAEV 123          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_YEAST (Putative cysteine synthase OS=Saccharomyces cerevisiae GN=YGR012W PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 6.239e-15
Identity = 48/115 (41.74%), Postives = 65/115 (56.52%), Query Frame = 2
Query:  266 VTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKG-LIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPA 607
            V ELIG TPLV +  +       I AKLE+  P  S KDR+  ++I  AEE G L+R     + E TSG+TGI +A +  A GYR  I++P   SLE+  +L + GA +    PA
Sbjct:   49 VEELIGNTPLVKIRSLTKATGVNIYAKLELCNPAGSAKDRVALNIIKTAEELGELVRGEPGWVFEGTSGSTGISIAVVCNALGYRAHISLPDDTSLEKLALLESLGATVNKVKPA 163          
The following BLAST results are available for this feature:
BLAST of FC931458 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 64
Match NameE-valueIdentityDescription
CYSM_PSEAE5.270e-2246.40Cysteine synthase B OS=Pseudomonas aeruginosa GN=c... [more]
CYSM_PSESY6.883e-2247.20Cysteine synthase B (Fragment) OS=Pseudomonas syri... [more]
MCCA_BACSU1.533e-2143.75O-acetylserine dependent cystathionine beta-syntha... [more]
CYSM_MYCTU2.002e-2146.15Cysteine synthase B OS=Mycobacterium tuberculosis ... [more]
CYSM_MYCBO2.002e-2146.15Cysteine synthase B OS=Mycobacterium bovis GN=cysM... [more]
CYSM_CAMJE3.777e-2043.75Cysteine synthase B OS=Campylobacter jejuni GN=cys... [more]
CYSM_AQUAE6.442e-2045.16Cysteine synthase OS=Aquifex aeolicus GN=cysM PE=3... [more]
CYSK_EMENI5.453e-1946.30Cysteine synthase OS=Emericella nidulans GN=cysB P... [more]
CYSK1_SCHPO3.308e-1644.23Cysteine synthase 1 OS=Schizosaccharomyces pombe G... [more]
CYSK_YEAST6.239e-1541.74Putative cysteine synthase OS=Saccharomyces cerevi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34105C12EF PostHarvP1 Citrus clementina cDNA clone C34105C12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931458 ID=FC931458|Name=FC931458|organism=Citrus clementina|type=EST|length=640bp
GATGTTTATTTATTTATTCATTTTTATTTTTTGTTTTGTTCTATATTTCT
CATTTGGCCGCCTGAAGAATATTTATATAAGCAAAATCATCGTAACGCAT
AAACATAATTATTATCGGGAGATTTATTTGTTTTTCAATTTTCTACTGTT
TTCCAGCTGCCTTGACATTGTTTACGATTCTTCCCAGAGAAAGCTTTCGC
GTTCGCTTGTAACTTGAAAAAAAGAAAAAAAAATGGTGGAGGAGAAGTCC
GTGATTGCGAAAGATGTCACTGAATTGATTGGTAAAACACCATTGGTGTA
TCTCAACCGCATTGTGGATGGTTGCGTTGCTAGAATTGCTGCCAAGCTGG
AGATGATGGAACCCTGCTCTAGCGTCAAAGATAGAATTGGATACAGTATG
ATCGCTGATGCAGAGGAGAAGGGTCTCATTAGACCAGGCGAGAGTGTCCT
GATTGAGCCTACCAGCGGTAATACTGGCATAGGGTTGGCATTCATGGCAG
CTGCTAAGGGTTACAGACTTATAATTACCATGCCTGCTTCAATGAGTCTT
GAAAGAAGAATGGTTCTCCTAGCTTTTGGAGCTGAGCTTGTGCTCACTGA
TCCTGCCAGGGGCATGAAGAGAGCTGTTCAGAAGGCAGAA
back to top