FC931458

Overview
NameFC931458
Unique NameFC931458
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length640
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC931458_ssr5 microsatellite FC931458_ssr5:5..16. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig15332 contig Ccv1_Contig15332:1..640. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_DICDI (Cysteine synthase OS=Dictyostelium discoideum GN=cysK PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.390e-14
Identity = 44/126 (34.92%), Postives = 71/126 (56.35%), Query Frame = 2
Query:  248 SVIAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRA 625
            S I+  + E +G TPL+ +  + +     I  K E M P  S KDR+   +I D E+KGL++ G S ++E T+G+TGI L  +  ++GY + + +P ++S E+  +L   GAE  +  P  GM  A
Sbjct:   36 SGISNGIIETVGNTPLIRIKSLSEATGCEIYGKAEFMNPGGSPKDRVAREIILDGEKKGLLKKG-STIVEATAGSTGISLTMLGKSRGYNVQLFIPDNVSKEKVDLLEMLGAETKIV-PIVGMNNA 159          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSM_HELPY (Cysteine synthase OS=Helicobacter pylori GN=cysM PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.699e-12
Identity = 44/132 (33.33%), Postives = 77/132 (58.33%), Query Frame = 2
Query:  251 VIAKDVTELIGKTPLV-YLNRIVDGCV-ARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            +I   + + IG+TP+  + N+     + + I AKLE + P  SVKDR+G  +I +  + G I   ++ +IEPT+GNTGI LA +A     + I  +P   S E++ ++ A GA ++ T  + G+  A++K++
Sbjct:    2 MIITTMQDAIGRTPVFKFTNKDYPIPLNSAIYAKLEHLNPGGSVKDRLGQYLIGEGFKTGKIT-SKTTIIEPTAGNTGIALALVAIKHHLKTIFVVPEKFSTEKQQIMRALGALVINTPTSEGISGAIKKSK 132          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSM_HELPJ (Cysteine synthase OS=Helicobacter pylori J99 GN=cysM PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 4.944e-12
Identity = 44/132 (33.33%), Postives = 72/132 (54.55%), Query Frame = 2
Query:  251 VIAKDVTELIGKTPLVYLNR--IVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            +I   + + IG+TP+    R        + I AKLE + P  SVKDR+G  +I +A     I    + +IEPT+GNTGI LA +A     + I  +P   S E++ ++ A GA ++ T  + G+  A++K++
Sbjct:    1 MILTAMQDAIGRTPIFKFTRKDYPIPLKSAIYAKLEHLNPGGSVKDRLGQYLIKEAFRTRKIT-STTTIIEPTAGNTGIALALVAIKHHLKTIFVVPKKFSTEKQQIMRALGALVINTPTSEGISGAIKKSK 131          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK2_SCHPO (Cysteine synthase 2 OS=Schizosaccharomyces pombe GN=cys12 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.879e-11
Identity = 43/119 (36.13%), Postives = 61/119 (51.26%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGES-VLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPA 607
            I   V  LIG T +V +  +       I AK E + P +S KDR+   MI  AEE G + P +S  + E T+G+TGI +A +  + GY   I MP+  S E+  +L   GA +    PA
Sbjct:   42 IVNGVEGLIGNTKMVRIKSLSQATGCDILAKAEFLNPGNSPKDRVALQMIRTAEENGDLVPYQSNAVYEGTAGSTGISIAMLCCSLGYDSRIYMPSDQSKEKSDILELLGAHVQRVTPA 160          
The following BLAST results are available for this feature:
BLAST of FC931458 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 64
Match NameE-valueIdentityDescription
CYSK_DICDI1.390e-1434.92Cysteine synthase OS=Dictyostelium discoideum GN=c... [more]
CYSM_HELPY1.699e-1233.33Cysteine synthase OS=Helicobacter pylori GN=cysM P... [more]
CYSM_HELPJ4.944e-1233.33Cysteine synthase OS=Helicobacter pylori J99 GN=cy... [more]
CYSK2_SCHPO1.879e-1136.13Cysteine synthase 2 OS=Schizosaccharomyces pombe G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34105C12EF PostHarvP1 Citrus clementina cDNA clone C34105C12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931458 ID=FC931458|Name=FC931458|organism=Citrus clementina|type=EST|length=640bp
GATGTTTATTTATTTATTCATTTTTATTTTTTGTTTTGTTCTATATTTCT
CATTTGGCCGCCTGAAGAATATTTATATAAGCAAAATCATCGTAACGCAT
AAACATAATTATTATCGGGAGATTTATTTGTTTTTCAATTTTCTACTGTT
TTCCAGCTGCCTTGACATTGTTTACGATTCTTCCCAGAGAAAGCTTTCGC
GTTCGCTTGTAACTTGAAAAAAAGAAAAAAAAATGGTGGAGGAGAAGTCC
GTGATTGCGAAAGATGTCACTGAATTGATTGGTAAAACACCATTGGTGTA
TCTCAACCGCATTGTGGATGGTTGCGTTGCTAGAATTGCTGCCAAGCTGG
AGATGATGGAACCCTGCTCTAGCGTCAAAGATAGAATTGGATACAGTATG
ATCGCTGATGCAGAGGAGAAGGGTCTCATTAGACCAGGCGAGAGTGTCCT
GATTGAGCCTACCAGCGGTAATACTGGCATAGGGTTGGCATTCATGGCAG
CTGCTAAGGGTTACAGACTTATAATTACCATGCCTGCTTCAATGAGTCTT
GAAAGAAGAATGGTTCTCCTAGCTTTTGGAGCTGAGCTTGTGCTCACTGA
TCCTGCCAGGGGCATGAAGAGAGCTGTTCAGAAGGCAGAA
back to top