BG733602
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of BG733602 vs. ExPASy Swiss-Prot
Match: EF1A_APIME (Elongation factor 1-alpha OS=Apis mellifera PE=3 SV=1) HSP 1 Score: 95.9005 bits (237), Expect = 3.266e-21 Identity = 46/52 (88.46%), Postives = 47/52 (90.38%), Query Frame = 2 Query: 2 DSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERE 157 DSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLKAERE Sbjct: 17 DSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 68 HSP 2 Score: 25.0238 bits (53), Expect = 3.266e-21 Identity = 10/10 (100.00%), Postives = 10/10 (100.00%), Query Frame = 3 Query: 165 ITIDIALWKF 194 ITIDIALWKF Sbjct: 71 ITIDIALWKF 80
BLAST of BG733602 vs. ExPASy Swiss-Prot
Match: EF1A4_OSCTI (Elongation factor 1-alpha 4 OS=Oscheius tipulae GN=eft-4 PE=3 SV=1) HSP 1 Score: 95.9005 bits (237), Expect = 3.266e-21 Identity = 46/52 (88.46%), Postives = 47/52 (90.38%), Query Frame = 2 Query: 2 DSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERE 157 DSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLKAERE Sbjct: 17 DSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 68 HSP 2 Score: 25.0238 bits (53), Expect = 3.266e-21 Identity = 10/10 (100.00%), Postives = 10/10 (100.00%), Query Frame = 3 Query: 165 ITIDIALWKF 194 ITIDIALWKF Sbjct: 71 ITIDIALWKF 80
BLAST of BG733602 vs. ExPASy Swiss-Prot
Match: EF1A3_OSCTI (Elongation factor 1-alpha 3 OS=Oscheius tipulae GN=eft-3 PE=3 SV=1) HSP 1 Score: 95.9005 bits (237), Expect = 3.266e-21 Identity = 46/52 (88.46%), Postives = 47/52 (90.38%), Query Frame = 2 Query: 2 DSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERE 157 DSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLKAERE Sbjct: 18 DSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 69 HSP 2 Score: 25.0238 bits (53), Expect = 3.266e-21 Identity = 10/10 (100.00%), Postives = 10/10 (100.00%), Query Frame = 3 Query: 165 ITIDIALWKF 194 ITIDIALWKF Sbjct: 72 ITIDIALWKF 81
BLAST of BG733602 vs. ExPASy Swiss-Prot
Match: EF1A2_OSCTI (Elongation factor 1-alpha 2 OS=Oscheius tipulae GN=eft-2 PE=3 SV=1) HSP 1 Score: 95.9005 bits (237), Expect = 3.266e-21 Identity = 46/52 (88.46%), Postives = 47/52 (90.38%), Query Frame = 2 Query: 2 DSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERE 157 DSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLKAERE Sbjct: 17 DSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 68 HSP 2 Score: 25.0238 bits (53), Expect = 3.266e-21 Identity = 10/10 (100.00%), Postives = 10/10 (100.00%), Query Frame = 3 Query: 165 ITIDIALWKF 194 ITIDIALWKF Sbjct: 71 ITIDIALWKF 80
BLAST of BG733602 vs. ExPASy Swiss-Prot
Match: EF1A1_OSCTI (Elongation factor 1-alpha 1 OS=Oscheius tipulae GN=eft-1 PE=3 SV=1) HSP 1 Score: 95.9005 bits (237), Expect = 3.266e-21 Identity = 46/52 (88.46%), Postives = 47/52 (90.38%), Query Frame = 2 Query: 2 DSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERE 157 DSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLKAERE Sbjct: 17 DSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 68 HSP 2 Score: 25.0238 bits (53), Expect = 3.266e-21 Identity = 10/10 (100.00%), Postives = 10/10 (100.00%), Query Frame = 3 Query: 165 ITIDIALWKF 194 ITIDIALWKF Sbjct: 71 ITIDIALWKF 80
BLAST of BG733602 vs. ExPASy Swiss-Prot
Match: EF1A1_RHIRA (Elongation factor 1-alpha OS=Rhizomucor racemosus GN=TEF-1 PE=3 SV=1) HSP 1 Score: 95.9005 bits (237), Expect = 3.266e-21 Identity = 46/52 (88.46%), Postives = 47/52 (90.38%), Query Frame = 2 Query: 2 DSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERE 157 DSGKSTTTGHLIYK GGIDKR IE FEKEAAE+ K SFKYAWVLDKLKAERE Sbjct: 17 DSGKSTTTGHLIYKCGGIDKRTIEEFEKEAAELGKGSFKYAWVLDKLKAERE 68 HSP 2 Score: 25.0238 bits (53), Expect = 3.266e-21 Identity = 10/10 (100.00%), Postives = 10/10 (100.00%), Query Frame = 3 Query: 165 ITIDIALWKF 194 ITIDIALWKF Sbjct: 71 ITIDIALWKF 80
BLAST of BG733602 vs. ExPASy Swiss-Prot
Match: EF1A_CRYPV (Elongation factor 1-alpha OS=Cryptosporidium parvum PE=2 SV=1) HSP 1 Score: 97.4413 bits (241), Expect = 3.269e-21 Identity = 46/52 (88.46%), Postives = 49/52 (94.23%), Query Frame = 2 Query: 2 DSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERE 157 DSGKSTTTGHLIYKLGGIDKR IE+FEKE++EM K SFKYAWVLDKLKAERE Sbjct: 17 DSGKSTTTGHLIYKLGGIDKRTIEKFEKESSEMGKGSFKYAWVLDKLKAERE 68 HSP 2 Score: 23.483 bits (49), Expect = 3.269e-21 Identity = 9/10 (90.00%), Postives = 10/10 (100.00%), Query Frame = 3 Query: 165 ITIDIALWKF 194 ITIDIALW+F Sbjct: 71 ITIDIALWQF 80
BLAST of BG733602 vs. ExPASy Swiss-Prot
Match: EF1A_SPOFR (Elongation factor 1-alpha (Fragment) OS=Spodoptera frugiperda PE=1 SV=1) HSP 1 Score: 95.9005 bits (237), Expect = 3.272e-21 Identity = 46/52 (88.46%), Postives = 47/52 (90.38%), Query Frame = 2 Query: 2 DSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERE 157 DSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLKAERE Sbjct: 3 DSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 54 HSP 2 Score: 25.0238 bits (53), Expect = 3.272e-21 Identity = 10/10 (100.00%), Postives = 10/10 (100.00%), Query Frame = 3 Query: 165 ITIDIALWKF 194 ITIDIALWKF Sbjct: 57 ITIDIALWKF 66
BLAST of BG733602 vs. ExPASy Swiss-Prot
Match: EF1A_HELZE (Elongation factor 1-alpha (Fragment) OS=Heliothis zea PE=3 SV=1) HSP 1 Score: 95.9005 bits (237), Expect = 3.272e-21 Identity = 46/52 (88.46%), Postives = 47/52 (90.38%), Query Frame = 2 Query: 2 DSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERE 157 DSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLKAERE Sbjct: 3 DSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 54 HSP 2 Score: 25.0238 bits (53), Expect = 3.272e-21 Identity = 10/10 (100.00%), Postives = 10/10 (100.00%), Query Frame = 3 Query: 165 ITIDIALWKF 194 ITIDIALWKF Sbjct: 57 ITIDIALWKF 66
BLAST of BG733602 vs. ExPASy Swiss-Prot
Match: EF1A_HELVI (Elongation factor 1-alpha (Fragment) OS=Heliothis virescens PE=3 SV=1) HSP 1 Score: 95.9005 bits (237), Expect = 3.272e-21 Identity = 46/52 (88.46%), Postives = 47/52 (90.38%), Query Frame = 2 Query: 2 DSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERE 157 DSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLKAERE Sbjct: 3 DSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 54 HSP 2 Score: 25.0238 bits (53), Expect = 3.272e-21 Identity = 10/10 (100.00%), Postives = 10/10 (100.00%), Query Frame = 3 Query: 165 ITIDIALWKF 194 ITIDIALWKF Sbjct: 57 ITIDIALWKF 66 The following BLAST results are available for this feature:
BLAST of BG733602 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 103
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >BG733602 ID=BG733602; Name=BG733602; organism=Citrus sinensis; type=EST; length=194bpback to top |