BG791315
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of BG791315 vs. ExPASy Swiss-Prot
Match: FTHS_CLOBA (Formate--tetrahydrofolate ligase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=fhs PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 2.614e-11 Identity = 33/65 (50.77%), Postives = 42/65 (64.62%), Query Frame = 2 Query: 32 LPICMAKTQYSFSHNAAEKGAPTGFILPIRDVRASIGAGFIYPLVGTMSTMPGLPTRPCFYEIDV 226 LPICMAKTQYS S N P+GF + ++++R S GAGFI G + TMPGLP P ++DV Sbjct: 482 LPICMAKTQYSLSDNPNLLAKPSGFNINVQEIRVSNGAGFIVVQTGNIMTMPGLPKVPAANKMDV 546
BLAST of BG791315 vs. ExPASy Swiss-Prot
Match: FTHS_DESAH (Formate--tetrahydrofolate ligase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=fhs PE=3 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 5.823e-11 Identity = 33/65 (50.77%), Postives = 41/65 (63.08%), Query Frame = 2 Query: 32 LPICMAKTQYSFSHNAAEKGAPTGFILPIRDVRASIGAGFIYPLVGTMSTMPGLPTRPCFYEIDV 226 L +CM KT S S N + KG PTG+ L IR+V GAGFI P+ GT+S MPG + P F +DV Sbjct: 516 LGMCMVKTHLSLSDNPSLKGVPTGWRLMIREVLTYGGAGFIVPVAGTISLMPGTGSNPAFKRVDV 580
BLAST of BG791315 vs. ExPASy Swiss-Prot
Match: FTHS_THESQ (Formate--tetrahydrofolate ligase OS=Thermotoga sp. (strain RQ2) GN=fhs PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.932e-11 Identity = 31/69 (44.93%), Postives = 43/69 (62.32%), Query Frame = 2 Query: 20 GFSGLPICMAKTQYSFSHNAAEKGAPTGFILPIRDVRASIGAGFIYPLVGTMSTMPGLPTRPCFYEIDV 226 GF LP+ +AKT S SH+ + +GAP G+ + D+ S GAGF+ L G ++ MPGLP RP +DV Sbjct: 464 GFDELPVIVAKTPKSISHDPSLRGAPEGYTFVVSDLFVSAGAGFVVALSGDINLMPGLPERPNALNMDV 532
BLAST of BG791315 vs. ExPASy Swiss-Prot
Match: FTHS_THEP1 (Formate--tetrahydrofolate ligase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=fhs PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.932e-11 Identity = 31/69 (44.93%), Postives = 43/69 (62.32%), Query Frame = 2 Query: 20 GFSGLPICMAKTQYSFSHNAAEKGAPTGFILPIRDVRASIGAGFIYPLVGTMSTMPGLPTRPCFYEIDV 226 GF LP+ +AKT S SH+ + +GAP G+ + D+ S GAGF+ L G ++ MPGLP RP +DV Sbjct: 464 GFDELPVIVAKTPKSISHDPSLRGAPEGYTFVVSDLFVSAGAGFVVALSGDINLMPGLPERPNALNMDV 532
BLAST of BG791315 vs. ExPASy Swiss-Prot
Match: FTHS_DESPS (Formate--tetrahydrofolate ligase OS=Desulfotalea psychrophila GN=fhs PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.932e-11 Identity = 30/65 (46.15%), Postives = 39/65 (60.00%), Query Frame = 2 Query: 32 LPICMAKTQYSFSHNAAEKGAPTGFILPIRDVRASIGAGFIYPLVGTMSTMPGLPTRPCFYEIDV 226 L CM KT S SH+ KG P G+ LPIRD+ GAGF+ P+ G +S MPG + P + +DV Sbjct: 482 LGTCMVKTHLSLSHDPKLKGVPKGWTLPIRDILTYKGAGFVVPVAGAISLMPGTGSDPAYRRVDV 546 The following BLAST results are available for this feature:
BLAST of BG791315 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 275
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >BG791315 ID=BG791315; Name=BG791315; organism=Citrus sinensis; type=EST; length=226bpback to top |