BQ622924

Overview
NameBQ622924
Unique NameBQ622924
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length670
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
BQ622924_ssr546 microsatellite BQ622924_ssr546:546..566. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig3539 contig Csv1_Contig3539:145..814. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_MYCH7 (30S ribosomal protein S9 OS=Mycoplasma hyopneumoniae (strain 7448) GN=rpsI PE=3 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.659e-29
Identity = 70/125 (56.00%), Postives = 90/125 (72.00%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            +GTGRRK ++ARV L+ G G+F IN R AKEYL+ + L    ++ PL      + +++ V AHGGG+SGQA AI LG+ARALLKVS D+R  LK  G+LTRD+R  ERKK GL KAR+A Q+SKR
Sbjct:    9 YGTGRRKSSVARVTLKHGNGQFKINNRVAKEYLKSDILIKDALQ-PLSITNTVSEFNIRVNAHGGGISGQAGAIRLGIARALLKVSADYRPGLKVAGMLTRDARAKERKKFGLRKARRARQFSKR 132          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_MYCH2 (30S ribosomal protein S9 OS=Mycoplasma hyopneumoniae (strain 232) GN=rpsI PE=3 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.659e-29
Identity = 70/125 (56.00%), Postives = 90/125 (72.00%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            +GTGRRK ++ARV L+ G G+F IN R AKEYL+ + L    ++ PL      + +++ V AHGGG+SGQA AI LG+ARALLKVS D+R  LK  G+LTRD+R  ERKK GL KAR+A Q+SKR
Sbjct:    9 YGTGRRKSSVARVTLKHGNGQFKINNRVAKEYLKSDILIKDALQ-PLSITNTVSEFNIRVNAHGGGISGQAGAIRLGIARALLKVSADYRPGLKVAGMLTRDARAKERKKFGLRKARRARQFSKR 132          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_STRU0 (30S ribosomal protein S9 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rpsI PE=3 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 2.830e-29
Identity = 71/124 (57.26%), Postives = 84/124 (67.74%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GTGRRK A+ARV L  GTGK  +N +D +EY+    L L  I  P      E SYDVFV  +GGG  GQ+ AI  G+ARALL+V  D R  LK+ GLLTRD+R+VERKK GL KARKA Q+SKR
Sbjct:    8 GTGRRKNAVARVRLVPGTGKITVNSKDVEEYIPHADLRL-VINQPFAVTSTEGSYDVFVNVNGGGYGGQSGAIRHGIARALLQVDPDFRDSLKRAGLLTRDARMVERKKPGLKKARKASQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_PETMO (30S ribosomal protein S9 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rpsI PE=3 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 2.830e-29
Identity = 70/128 (54.69%), Postives = 84/128 (65.62%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIIN---YRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            +GTGRRK A+ARV L+ G GK  IN   Y+   EYL+GN +W      PL        +D+ ++ +GGGLSGQA AI LG+ARALL   +  R  LKKEGLLTRD R VERKK GL KARK  Q+SKR
Sbjct:    8 YGTGRRKTAVARVHLRPGNGKIKINGKEYKSLVEYLRGNEVWEIEALKPLTVTSTNGQFDLVIRVNGGGLSGQAGAIRLGIARALLSYDESFRPILKKEGLLTRDPREVERKKYGLRKARKRAQFSKR 135          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_GEOTN (30S ribosomal protein S9 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rpsI PE=3 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 2.830e-29
Identity = 68/125 (54.40%), Postives = 87/125 (69.60%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            +GTGRRK ++ARV L  G G+ I+N  D +EY+    L ++ +K PLV      SYDV V  HGGG +GQA AI  G+ARALL+V  + R+ LK+ GLLTRD+RV ERKK GL  AR+APQ+SKR
Sbjct:    7 YGTGRRKSSVARVRLVPGDGRIIVNKHDIREYIPSEAL-IEMVKQPLVLTETLGSYDVLVNVHGGGFAGQAGAIRHGIARALLEVDPEFRAVLKRAGLLTRDARVKERKKYGLKGARRAPQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_BACST (30S ribosomal protein S9 OS=Bacillus stearothermophilus GN=rpsI PE=1 SV=2)

HSP 1 Score: 128.257 bits (321), Expect = 3.696e-29
Identity = 68/125 (54.40%), Postives = 88/125 (70.40%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            +GTGRRK ++ARV L  G G+ I+N +D +EY+    L ++ +K PLV      SYDV V  HGGG +GQA AI  G+ARALL+V  + R+ LK+ GLLTRD+RV ERKK GL  AR+APQ+SKR
Sbjct:    7 YGTGRRKSSVARVRLVPGDGRIIVNKQDIREYIPTEAL-IEMVKQPLVLTETLGSYDVLVNVHGGGFAGQAGAIRHGIARALLQVDPEFRTVLKRAGLLTRDARVKERKKYGLKGARRAPQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_BIFAA (30S ribosomal protein S9 OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083) GN=rpsI PE=3 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 4.827e-29
Identity = 72/126 (57.14%), Postives = 88/126 (69.84%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQD-HRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            +GTGRRK A+ARV L  GTGK+ IN R  +EY     L  + +  P+V L  E  +D  V   GGG +GQA AI LGVARAL  + +D +R+ LKK G LTRD+RVVERKKAGLHKAR+APQ+SKR
Sbjct:   39 YGTGRRKEAVARVRLVPGTGKWTINGRTLEEYFPAKLLQRE-VNSPIVLLKLEGKFDAIVLVDGGGTTGQAGAIRLGVARALNAIDRDANRAALKKAGFLTRDARVVERKKAGLHKARRAPQFSKR 163          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_STRS7 (30S ribosomal protein S9 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rpsI PE=3 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 6.304e-29
Identity = 71/124 (57.26%), Postives = 84/124 (67.74%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GTGRRK A+ARV L  GTGK  +N +D +EY+    L L  I  P      E SYDVFV   GGG +GQ+ AI  G+ARALL+V  D R  LK+ GLLTRD+R+VERKK GL KARKA Q+SKR
Sbjct:    8 GTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRL-IINQPFAVTSTEGSYDVFVNVVGGGYAGQSGAIRHGIARALLQVDPDFRDSLKRAGLLTRDARMVERKKPGLKKARKASQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_STRS2 (30S ribosomal protein S9 OS=Streptococcus suis (strain 98HAH33) GN=rpsI PE=3 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 6.304e-29
Identity = 70/124 (56.45%), Postives = 84/124 (67.74%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GTGRRK A+ARV L  GTGK  +N +D +EY+    L L  I  P      + SYDVFV  +GGG  GQ+ AI  G+ARALL+V  D R  LK+ GLLTRD+R+VERKK GL KARKA Q+SKR
Sbjct:    8 GTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRL-VINQPFAVTSTQGSYDVFVNVNGGGYGGQSGAIRHGIARALLQVDPDFRDSLKRAGLLTRDARMVERKKPGLKKARKASQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_STRMU (30S ribosomal protein S9 OS=Streptococcus mutans GN=rpsI PE=3 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 6.304e-29
Identity = 71/124 (57.26%), Postives = 84/124 (67.74%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GTGRRK A+ARV L  GTGK  +N +D +EY+    L L  I  P      E SYDVFV   GGG +GQ+ AI  G+ARALL+V  D R  LK+ GLLTRD+R+VERKK GL KARKA Q+SKR
Sbjct:    8 GTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRL-VINQPFAVTSTEGSYDVFVNVVGGGYAGQSGAIRHGIARALLEVDPDFRDALKRAGLLTRDARMVERKKPGLKKARKASQFSKR 130          
The following BLAST results are available for this feature:
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RS9_MYCH71.659e-2956.0030S ribosomal protein S9 OS=Mycoplasma hyopneumoni... [more]
RS9_MYCH21.659e-2956.0030S ribosomal protein S9 OS=Mycoplasma hyopneumoni... [more]
RS9_STRU02.830e-2957.2630S ribosomal protein S9 OS=Streptococcus uberis (... [more]
RS9_PETMO2.830e-2954.6930S ribosomal protein S9 OS=Petrotoga mobilis (str... [more]
RS9_GEOTN2.830e-2954.4030S ribosomal protein S9 OS=Geobacillus thermodeni... [more]
RS9_BACST3.696e-2954.4030S ribosomal protein S9 OS=Bacillus stearothermop... [more]
RS9_BIFAA4.827e-2957.1430S ribosomal protein S9 OS=Bifidobacterium adoles... [more]
RS9_STRS76.304e-2957.2630S ribosomal protein S9 OS=Streptococcus equi sub... [more]
RS9_STRS26.304e-2956.4530S ribosomal protein S9 OS=Streptococcus suis (st... [more]
RS9_STRMU6.304e-2957.2630S ribosomal protein S9 OS=Streptococcus mutans G... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00015 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00015 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622924 ID=BQ622924|Name=BQ622924|organism=Citrus sinensis|type=EST|length=670bp
ACTGGTAGTATCGGCCACAGAAGCTGCGCCAGCTGAACTGGAAACAACTG
ACCTCAAGAAATACGTCAAGTCGAGGCTTCCCGGTGGCTTTGCGGCTCAA
ACTATTTTTGGAACGGGCCGTCGGAAATGCGCCATTGCTCGTGTCGTCCT
CCAAGAAGGCACCGGCAAATTCATCATCAACTACCGCGATGCCAAGGAAT
ATCTTCAAGGCAATCCACTATGGCTACAGTATATAAAAGTCCCTTTGGTA
ACTTTGGGTTATGAAACTAGCTATGATGTTTTTGTGAAAGCTCATGGTGG
CGGCCTCTCTGGTCAAGCTCAAGCAATAACACTCGGCGTTGCTCGTGCAT
TGTTGAAGGTGAGCCAGGACCATAGATCCCCTCTGAAAAAGGAAGGCCTT
CTGACTAGAGATTCCAGAGTAGTAGAGAGGAAAAAAGCTGGACTCCATAA
AGCCCGCAAAGCCCCACAGTATTCCAAACGTTGAGGCCAGAATTACAGTG
TGATGGACTGTTACCCGTAGATCTATTTTCTGCTTGTATCTCTGAATTAT
TATTATTATTATTATTTTTGGTTTAACATTTTATGTTTGGAGTTTTGTAC
TTCAGTTCCGGGTATCATGGAATCATAAACCATTTTTGATAAAAAAAACC
TAACAAAACAACTACAAAAA
back to top