BQ623089

Overview
NameBQ623089
Unique NameBQ623089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4AB_HUMAN (Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 4.726e-14
Identity = 46/158 (29.11%), Postives = 82/158 (51.90%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE--ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYD 465
            TT+  I+     LA HP       +E  +++ +   G  +T   + ++ YT    +E++RL+PP+ G  R+  + + + +G ++PKG  VL + +G H NP+ + +P  FDP RF    +   + +LPF GG R C G Q A   + +     + R++
Sbjct:  325 TTASGISWILYALATHPKHQERCREEIHSLLGD---GASITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHHNPKVWPNPEVFDPFRFAPGSAQHSHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRFE 479          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C524A_DICDI (Probable cytochrome P450 524A1 OS=Dictyostelium discoideum GN=cyp524a1 PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 4.726e-14
Identity = 53/188 (28.19%), Postives = 85/188 (45.21%), Query Frame = 1
Query:   13 AIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVY-----LPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDW--SLINPNESITMDPLPFPSQGMPIKISPK 552
            ++  T +++A+HPD  + +  E  ++  N    E L L+ M++  YT  V  E +R  PP      + + DI   +   +PKG  +L + +  H     + DP  FDP+RF+      V      L FG GP  C G +LAK  I +F+  +    +W  +     + I   P  FP  G  I I  +
Sbjct:  347 SLVWTVQLMAEHPDILAKVRAEQASLRPNN---EKLDLDTMRQATYTRMVVSEILRFRPPAVMVPHENIEDIVIGDNVHVPKGTMILPSIWSAHFQEGGYSDPYKFDPQRFDSVRKEDVTCAKNSLVFGAGPHFCIGKELAKNQIEVFLTKLAMSTEWTHNKTPGGDEIIFGPTIFPKDGCNITIKAR 531          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4F6_RAT (Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 6.173e-14
Identity = 48/159 (30.19%), Postives = 78/159 (49.06%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVP----PYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            TT+ A++     LA+HP+      QE   ++ ++   EI   +D+ ++ +     +ES+RL PP+    R    DI   +G  IPKG   + + FG H NP  + DP  ++P RF+   P    P  ++PF  GPR C G   A   I + +   + R+
Sbjct:  332 TTASALSWILYNLARHPEYQERCRQEVRELLRDREPEEI-EWDDLAQLPFLTMCIKESLRLHPPVLLISRCCSQDIVLPDGRVIPKGNICVISIFGVHHNPSVWPDPEVYNPFRFDPENPQKRSPLAFIPFSAGPRNCIGQTFAMSEIKVALALTLLRF 489          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C7D94_MENGR (Cytochrome P450 71D94 OS=Mentha gracilis GN=CYP71D94 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 6.173e-14
Identity = 40/122 (32.79%), Postives = 67/122 (54.92%), Query Frame = 1
Query:  124 LEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYV-----YLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSL 474
            L +M+++KY   V +E++RL PP     R++  + E  GF IP   ++L  A+    +P Y+EDP +F P RF+E    ++     ++PFG G R+C G      N+ I +  ++  +DW L
Sbjct:  338 LSEMQELKYMRSVVKETLRLHPPFPLIPRQSREECEINGFYIPARTRILINAWSIGRDPLYWEDPDTFRPERFDEVSRDFMGNDFEFIPFGAGQRICPGLHFGLANVEIPLAQLLYHFDWKL 459          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP6B1_PAPPO (Cytochrome P450 6B1 OS=Papilio polyxenes GN=CYP6B1 PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.053e-13
Identity = 48/160 (30.00%), Postives = 84/160 (52.50%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEG--FTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE-ESVP---PYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            T++  +   F  LA++PD    L+ E   +++       +T E + ++ Y  +V  E++R +P    + R A +D  + G   TI KG  ++ + +G  ++P+Y+ +P  FDP RF  E+V    P  YLPF  GPR C G + AK    + +  V+++Y
Sbjct:  307 TSATTMTYLFYELAKNPDIQDKLIAEIDEVLSRHDGN--ITYECLSEMTYLSKVFDETLRKYPVADFTQRNAKTDYVFPGTDITIKKGQTIIVSTWGIQNDPKYYPNPEKFDPERFNPENVKDRHPCAYLPFSAGPRNCLGMRFAKWQSEVCIMKVLSKY 464          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4F4_RAT (Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.053e-13
Identity = 46/159 (28.93%), Postives = 78/159 (49.06%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE----ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            TT+  ++     LA+HP+      QE   ++ ++ + EI   +D+ ++ +     +ES+RL PP+    R+   DI   +G  IPKG   +   F TH NP  + DP  +DP RF+    +   P  ++PF  GPR C G   A   + + +   + R+
Sbjct:  332 TTASGLSWILYNLARHPEYQERCRQEVRELLRDRESTEI-EWDDLAQLPFLTMCIKESLRLHPPVTVISRRCTQDIVLPDGRVIPKGVICIINIFATHHNPTVWPDPEVYDPFRFDPENIKDRSPLAFIPFSAGPRNCIGQTFAMNEMKVALALTLLRF 489          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4AO_PIG (Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.053e-13
Identity = 44/158 (27.85%), Postives = 81/158 (51.27%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE--ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYD 465
            TT+  I+     LA HP+      +E   ++ +   G  +T + + ++ YT    +E++RL+PP+ G  R+    I + +G ++P G  +  + +G H NP+ + +P  FDP RF    +   + ++PF GG R C G Q A   + + V   + R++
Sbjct:  319 TTASGISWILYALASHPEHQQRCREEIQGLLGD---GTSITWDHLDQMPYTTMCIKEALRLYPPVPGVSRELSKPITFPDGRSLPAGITLSLSIYGLHHNPQVWPNPEEFDPSRFAPGSARHSHAFMPFSGGSRNCIGKQFAMNEMKVAVALTLLRFE 473          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C80A1_BERST (Berbamunine synthase OS=Berberis stolonifera GN=CYP80A1 PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.053e-13
Identity = 59/197 (29.95%), Postives = 96/197 (48.73%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLED--MKKIKYTWQVARESMRLFPPIFGSF-RKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPY-----VYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLIN--PNESITMDPLPFPSQGM--PIKISPKL 555
            T S  I      L ++PD  + L +E   ++     G   T+++    ++ Y     +E+MRL+PPI      + +   +  G+TIPKG  V   A     +P+ ++DPL F P RF +S   Y      ++PFG G R+C G  LA   I + +  +V  + W L +  PNE + M+ L   S  M  P+++ PK+
Sbjct:  294 TNSNIIEWALAQLIKNPDKLAKLREELDRVV-----GRSSTVKESHFSELPYLQACVKETMRLYPPISIMIPHRCMETCQVMGYTIPKGMDVHVNAHAIGRDPKDWKDPLKFQPERFLDSDIEYNGKQFQFIPFGSGRRICPGRPLAVRIIPLVLASLVHAFGWELPDGVPNEKLDMEELFTLSLCMAKPLRVIPKV 485          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C71BM_ARATH (Cytochrome P450 71B22 OS=Arabidopsis thaliana GN=CYP71B22 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.053e-13
Identity = 55/169 (32.54%), Postives = 84/169 (49.70%), Query Frame = 1
Query:   13 AIAMTFKM--LAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSF-RKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESV-----PPYVYLPFGGGPRLCAG-------YQLAKLNIIIFVHYVVTRYDWSL 474
            AI M + M  LA+HP     L QE   I+ + +  E +T +D++K+ Y   V  E+ RL PP      R+ +SD++ +G+ IPK   +    +    +P  +E+P  F+P RF +S        Y  LPFG G R+C G        +L  LN++ F       +DWSL
Sbjct:  307 AITMIWAMTELARHPRVMKKLQQEIREILGDNK--EKITEQDLEKVHYLKLVIEETFRLHPPAPLLLPRETMSDLKIQGYNIPKNTMIEINTYSIGRDPNCWENPNDFNPERFIDSPVEYKGQHYELLPFGAGRRICPGMATGITIVELGLLNVLYF-------FDWSL 466          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4F3_MOUSE (Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.375e-13
Identity = 47/159 (29.56%), Postives = 77/159 (48.43%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE----ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            TT+  ++     LA+HP+      QE   ++ ++   EI   +D+ ++ +     +ES+RL PP+    R    DI   +G  IPKG     + FGTH NP  + DP  +DP RF+    +   P  ++PF  GPR C G   A   + + +   + R+
Sbjct:  332 TTASGLSWILYNLARHPEYQERCRQEVRELLRDREPEEI-EWDDLAQLPFLTMCIKESLRLHPPVTAISRCCTQDIVLPDGRVIPKGVISRISIFGTHHNPAVWPDPEVYDPFRFDADNVKGRSPLAFIPFSAGPRNCIGQTFAMSEMKVALALTLLRF 489          
The following BLAST results are available for this feature:
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 275
Match NameE-valueIdentityDescription
CP4AB_HUMAN4.726e-1429.11Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE... [more]
C524A_DICDI4.726e-1428.19Probable cytochrome P450 524A1 OS=Dictyostelium di... [more]
CP4F6_RAT6.173e-1430.19Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6... [more]
C7D94_MENGR6.173e-1432.79Cytochrome P450 71D94 OS=Mentha gracilis GN=CYP71D... [more]
CP6B1_PAPPO1.053e-1330.00Cytochrome P450 6B1 OS=Papilio polyxenes GN=CYP6B1... [more]
CP4F4_RAT1.053e-1328.93Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4... [more]
CP4AO_PIG1.053e-1327.85Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2... [more]
C80A1_BERST1.053e-1329.95Berbamunine synthase OS=Berberis stolonifera GN=CY... [more]
C71BM_ARATH1.053e-1332.54Cytochrome P450 71B22 OS=Arabidopsis thaliana GN=C... [more]
CP4F3_MOUSE1.375e-1329.56Leukotriene-B(4) omega-hydroxylase 2 OS=Mus muscul... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00180 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00180 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623089 ID=BQ623089|Name=BQ623089|organism=Citrus sinensis|type=EST|length=604bp
ACCACATCTTTTGCCATTGCCATGACGTTTAAGATGTTAGCGCAGCATCC
AGATTGCTATTCTCTCCTCCTACAAGAACATGTTAACATAATGAATAATA
AAAGAGCTGGCGAAATTCTAACACTGGAAGACATGAAGAAGATAAAATAC
ACCTGGCAAGTTGCTCGCGAAAGCATGCGGCTCTTCCCTCCCATCTTCGG
CTCCTTCAGAAAAGCAGTTTCTGACATTGAGTATGAGGGATTCACCATTC
CTAAAGGCTGGAAGGTTTTATGGACAGCATTTGGAACACATTCGAATCCG
GAGTATTTTGAAGATCCTCTGAGTTTCGATCCCAGAAGGTTCGAGGAATC
AGTGCCTCCATATGTCTATCTTCCATTCGGAGGAGGGCCAAGATTGTGCG
CAGGCTACCAACTGGCCAAGCTAAACATCATCATCTTTGTTCATTATGTT
GTAACTCGCTATGATTGGTCTTTAATTAATCCCAACGAGTCAATCACCAT
GGATCCTCTCCCATTTCCTTCCCAAGGAATGCCCATCAAGATTTCTCCCA
AGTTGTAAACAACCAGCAATACGGCTGGGATTTTTCCTTACATAATTATG
TTGG
back to top