BQ623089

Overview
NameBQ623089
Unique NameBQ623089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP51_CUNEL (Lanosterol 14-alpha demethylase OS=Cunninghamella elegans GN=CYP51 PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.593e-12
Identity = 52/185 (28.11%), Postives = 80/185 (43.24%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSD-IEYE--GFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPY------------------------VYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSL 474
            T++   A T   LA  PD    L +E +  + + +A   LT +++K +       RE++RL PPIF   R+ V+D I YE  G  IPKG  +      T  +P YF +P +++P R+ E   P                          +LPFG G   C G Q   L +   +   +  +D+ L
Sbjct:  301 TSATTSAWTILELANRPDIIKALREEQIEKLGSLKAD--LTFDNLKDLPLLEAAIRETLRLHPPIFQMMRRVVADKIVYEKNGMEIPKGNFICAAPGVTQVDPTYFNEPTTYNPYRWIEKTDPVHQLEQGDDANIDYGFGAVGISSKSPFLPFGAGRHRCIGEQFGYLQLKTVISTFIRTFDFDL 483          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4X1_HUMAN (Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.593e-12
Identity = 46/162 (28.40%), Postives = 79/162 (48.77%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVP----PYVYLPFGGGPRLCAGYQLAKLNI-----IIFVHYVVT 456
            T + +I+     LA +P+      +E   I+ +   G  +T + + ++ YT    +E+ RL P +    R     + + +G T+P G  V+ + +G H NP  +++P  FDP RF +       PY YLPF  G R C G + A + +     +I +H+ VT
Sbjct:  320 TLAASISWILYCLALNPEHQERCREEVRGILGD---GSSITWDQLGEMSYTTMCIKETCRLIPAVPSISRDLSKPLTFPDGCTLPAGITVVLSIWGLHHNPAVWKNPKVFDPLRFSQENSDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRVT 478          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP24A_HUMAN (1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=2 SV=2)

HSP 1 Score: 72.0182 bits (175), Expect = 2.593e-12
Identity = 50/184 (27.17%), Postives = 92/184 (50.00%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF---EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITM--DPLPFPSQGMPI 537
            TT+ ++      L+++P     LL+E  +++      ++   ED++ + Y     +ESMRL P +  + R          + +PKG  ++       S+ + FED   F P R+   +E + P+ +LPFG G R+C G +LA+L + + + ++V +YD    + NE + M       PS+ +PI
Sbjct:  330 TTANSLMWILYNLSRNPQVQQKLLKEIQSVLPEN---QVPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLGEYALPKGTVLMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATD-NEPVEMLHSGTLVPSRELPI 509          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C76C4_ARATH (Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.593e-12
Identity = 45/134 (33.58%), Postives = 68/134 (50.75%), Query Frame = 1
Query:  130 DMKKIKYTWQVARESMRLFP--PIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF-----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLIN--PNESITMD 504
            D+  + Y   V +E+ RL P  P+    RKA SD+E  GF +PK  +VL   +    +P  +E+P  F+P RF     +     Y   PFGGG R+C G  LA   + + +  ++  +DW L N   +E + MD
Sbjct:  355 DISGLPYLQAVVKETFRLHPAAPLLVP-RKAESDVEVLGFMVPKDTQVLVNVWAIGRDPSVWENPSQFEPERFMGKDIDVKGRDYELTPFGGGRRICPGLPLAVKTVSLMLASLLYSFDWKLPNGVVSEDLDMD 487          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C71BZ_ARATH (Cytochrome P450 71B38 OS=Arabidopsis thaliana GN=CYP71B38 PE=2 SV=2)

HSP 1 Score: 72.0182 bits (175), Expect = 2.593e-12
Identity = 54/165 (32.73%), Postives = 79/165 (47.88%), Query Frame = 1
Query:   25 TFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSF-RKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPY-----VYLPFGGGPRLCAG-------YQLAKLNIIIFVHYVVTRYDWSLIN 480
            T   L++HP     L QE +  M      E +T ED++K++Y   V  E+ RL PP      R  +SDI+ +G+ IPK   +    +    +P+Y++ P  F P RF +S   Y       LPFG G R+C G        +L  LN++ F       +DWSL N
Sbjct:  313 TLTELSRHPRVMKKL-QEEIRAMLGPNK-ERITEEDLEKVEYLKLVMVETFRLHPPAPLLLPRLTMSDIKIQGYNIPKNTMIQINTYAIGRDPKYWKQPGEFIPERFLDSPIDYKGQHFELLPFGAGRRICPGMATGITMVELGLLNLLYF-------FDWSLPN 468          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C508D_DICDI (Probable cytochrome P450 508D1 OS=Dictyostelium discoideum GN=cyp508d1 PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.593e-12
Identity = 50/141 (35.46%), Postives = 68/141 (48.23%), Query Frame = 1
Query:   55 CYSLLLQEHV-NIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPI-FGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNII-----IFVHYVVT 456
            C +  +Q+ V N +     G ++TL D     YT    +E++RL  P  FG       DI  +G  IPK   VL   +    NP+ F DPL FDP RF  S P   ++PFG GPR C G  L    I      IF+++ +T
Sbjct:  313 CNNQQIQDTVYNELKETVVGPVVTLNDRPSTPYTMACIKETIRLKAPAPFGLPHTTDQDIIVKGHFIPKDSMVLINFYSLGRNPKDFPDPLKFDPNRFIGSTPD-SFMPFGTGPRNCIGQALGMDQIYLLLSNIFLNFKIT 452          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP6A2_DROME (Cytochrome P450 6a2 OS=Drosophila melanogaster GN=Cyp6a2 PE=2 SV=2)

HSP 1 Score: 71.633 bits (174), Expect = 3.387e-12
Identity = 57/205 (27.80%), Postives = 94/205 (45.85%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIE---YEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE-------ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKISPKL*TTSNTAGIF 585
            T+S  ++     LAQ+ D    L  E   ++  +     LT E +K + Y  QV  E++RL+  +    RKA++D     +E   I KG +V+  A   H + + + +P +FDP RF        ESV    +LPFG GPR C G +  ++   I +  +++R+  S+ +  E             +P+K SP         GI+
Sbjct:  314 TSSSTMSYCLYELAQNQDIQDRLRNEIQTVLEEQEGQ--LTYESIKAMTYLNQVISETLRLYTLVPHLERKALNDYVVPGHEKLVIEKGTQVIIPACAYHRDEDLYPNPETFDPERFSPEKVAARESVE---WLPFGDGPRNCIGMRFGQMQARIGLAQIISRFRVSVCDTTE-------------IPLKYSPMSIVLGTVGGIY 500          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4G1_DROME (Cytochrome P450 4g1 OS=Drosophila melanogaster GN=Cyp4g1 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 3.387e-12
Identity = 44/160 (27.50%), Postives = 75/160 (46.88%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEG--FTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            TTS   +    M+  H D  + +  E   I  +    +  T  D  ++KY  +V  E++RL+PP+    R+   D++     +T+PKG  V+   +  H  P+ + +P  FDP  F      +   Y ++PF  GPR C G + A L + + +  +V  Y
Sbjct:  360 TTSAGSSFALCMMGIHKDIQAKVFAEQKAIFGDNMLRDC-TFADTMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASGPYTVPKGTTVIVLQYCVHRRPDIYPNPTKFDPDNFLPERMANRHYYSFIPFSAGPRSCVGRKYAMLKLKVLLSTIVRNY 518          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4F1_RAT (Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 3.387e-12
Identity = 46/159 (28.93%), Postives = 76/159 (47.80%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE----ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            TT+  ++     LA  P+      QE   ++ ++   EI   +D+ ++ +     +ES+RL PP+    R    DI   +G TIPKG   L + FG H NP  + DP  ++P RF+    +   P  ++PF  GPR C G   A   + + +   + R+
Sbjct:  332 TTASGLSWILYNLANDPEYQERCRQEVQELLRDRDPEEI-EWDDLAQLPFLTMCIKESLRLHPPVTVISRCCTQDILLPDGRTIPKGIICLISIFGIHHNPSVWPDPEVYNPFRFDPENIKDSSPLAFIPFSAGPRNCIGQTFAMSEMKVALALTLLRF 489          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP24A_MOUSE (1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 3.387e-12
Identity = 50/189 (26.46%), Postives = 95/189 (50.26%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF---EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPF--PSQGMPIKISPK 552
            TT+ ++      L+++P     LL+E  +++ + +       ED++ + Y     +ESMRL P +  + R          +T+PKG  +        S+ + FED   F P R+   E+ + P+ +LPFG G R+C G +LA+L + + + +++ +Y+  +   +E + M  L    PS+ +PI   P+
Sbjct:  330 TTANSLMWILYNLSRNPQVQQRLLREIQSVLPDNQTPRA---EDVRNMPYLKACLKESMRLTPSVPFTTRTLDKPTVLGEYTLPKGTVLTLNTQVLGSSEDNFEDADKFRPERWLEKEKKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIIQKYN-IVATDSEPVEMLHLGILVPSRELPIAFCPR 514          
The following BLAST results are available for this feature:
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 275
Match NameE-valueIdentityDescription
CP51_CUNEL2.593e-1228.11Lanosterol 14-alpha demethylase OS=Cunninghamella ... [more]
CP4X1_HUMAN2.593e-1228.40Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2... [more]
CP24A_HUMAN2.593e-1227.171,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho... [more]
C76C4_ARATH2.593e-1233.58Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CY... [more]
C71BZ_ARATH2.593e-1232.73Cytochrome P450 71B38 OS=Arabidopsis thaliana GN=C... [more]
C508D_DICDI2.593e-1235.46Probable cytochrome P450 508D1 OS=Dictyostelium di... [more]
CP6A2_DROME3.387e-1227.80Cytochrome P450 6a2 OS=Drosophila melanogaster GN=... [more]
CP4G1_DROME3.387e-1227.50Cytochrome P450 4g1 OS=Drosophila melanogaster GN=... [more]
CP4F1_RAT3.387e-1228.93Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1... [more]
CP24A_MOUSE3.387e-1226.461,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00180 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00180 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623089 ID=BQ623089|Name=BQ623089|organism=Citrus sinensis|type=EST|length=604bp
ACCACATCTTTTGCCATTGCCATGACGTTTAAGATGTTAGCGCAGCATCC
AGATTGCTATTCTCTCCTCCTACAAGAACATGTTAACATAATGAATAATA
AAAGAGCTGGCGAAATTCTAACACTGGAAGACATGAAGAAGATAAAATAC
ACCTGGCAAGTTGCTCGCGAAAGCATGCGGCTCTTCCCTCCCATCTTCGG
CTCCTTCAGAAAAGCAGTTTCTGACATTGAGTATGAGGGATTCACCATTC
CTAAAGGCTGGAAGGTTTTATGGACAGCATTTGGAACACATTCGAATCCG
GAGTATTTTGAAGATCCTCTGAGTTTCGATCCCAGAAGGTTCGAGGAATC
AGTGCCTCCATATGTCTATCTTCCATTCGGAGGAGGGCCAAGATTGTGCG
CAGGCTACCAACTGGCCAAGCTAAACATCATCATCTTTGTTCATTATGTT
GTAACTCGCTATGATTGGTCTTTAATTAATCCCAACGAGTCAATCACCAT
GGATCCTCTCCCATTTCCTTCCCAAGGAATGCCCATCAAGATTTCTCCCA
AGTTGTAAACAACCAGCAATACGGCTGGGATTTTTCCTTACATAATTATG
TTGG
back to top