BQ623089

Overview
NameBQ623089
Unique NameBQ623089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4V3_MOUSE (Cytochrome P450 4V3 OS=Mus musculus GN=Cyp4v3 PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.017e-16
Identity = 49/143 (34.27%), Postives = 74/143 (51.75%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLA 417
            TT+ AI  +  +L  +P+    + QE   +    R+   +TLED+KK+KY   V +E++R+FP +    R    D E  G+ + KG + +   +  H +P YF DP  F P RF     +   PY Y+PF  GPR C G + A
Sbjct:  333 TTAAAINWSLYLLGTNPEVQRKVDQELDEVFG--RSHRPVTLEDLKKLKYLDCVIKETLRVFPSVPLFARSLSEDCEVGGYKVTKGTEAIIIPYALHRDPRYFPDPEEFRPERFFPENSQGRHPYAYVPFSAGPRNCIGQKFA 473          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: THAS_BOVIN (Thromboxane-A synthase OS=Bos taurus GN=TBXAS1 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.329e-16
Identity = 52/148 (35.14%), Postives = 82/148 (55.41%), Query Frame = 1
Query:   34 MLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGT-HSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            +LA +P+C   LL+E         A E  +L++   + Y   V +E++R++PP F   R A  D E  G  IP G  VL TA G  H +PE++ +P +F+P RF    ++   PY YLPFG GPR C G +L  L + + + +++ ++
Sbjct:  356 LLATNPECQEKLLEEVDCFSKEHLAPEYCSLQE--GLPYLDMVIKETLRMYPPAFRFTRVAAQDCEVLGQRIPAG-AVLETAVGALHYDPEHWPNPENFNPERFTAEAQQRRRPYTYLPFGAGPRSCLGVRLGLLELKLTLLHILRKF 500          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: THAS_HUMAN (Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3)

HSP 1 Score: 85.8853 bits (211), Expect = 1.736e-16
Identity = 51/148 (34.46%), Postives = 80/148 (54.05%), Query Frame = 1
Query:   34 MLAQHPDCYSLLLQEHVNIMNNKR-AGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            +LA +PDC   LL+E V++   K  A E  +LE+   + Y   V  E++R++PP F   R+A  D E  G  IP G  +       H +PE++  P +F+P RF     +   P+ YLPFG GPR C G +L  L + + + +V+ ++
Sbjct:  356 LLATNPDCQEKLLRE-VDVFKEKHMAPEFCSLEE--GLPYLDMVIAETLRMYPPAFRFTREAAQDCEVLGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEARQQHRPFTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKF 500          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP26B_DANRE (Cytochrome P450 26B1 OS=Danio rerio GN=cyp26b1 PE=2 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 1.736e-16
Identity = 51/148 (34.46%), Postives = 79/148 (53.38%), Query Frame = 1
Query:  118 LTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF-----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVV--TRYDWSLINPNESITMDPLPFPSQGMPIK 540
            L L+ +  +KY   V +E +RLF P+ G +R A    E +G  +PKGW V+++   TH     F+D  +FDP RF     E+    + YLPFGGG R C G QLA L + +    +   +R++ S       I++ P+  P+ G+ +K
Sbjct:  342 LRLDSIISLKYLDCVIKEVLRLFAPVSGGYRIATQTFELDGVQVPKGWSVMYSIRDTHDTSAVFKDVEAFDPDRFSPERSEDREGRFHYLPFGGGVRSCLGKQLATLFLKLLAVELAGGSRFELSTRTFPRMISV-PVVHPTDGLRVK 488          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: THAS_PIG (Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.267e-16
Identity = 57/181 (31.49%), Postives = 91/181 (50.28%), Query Frame = 1
Query:   34 MLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGT-HSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNE---SITMDPLPFPSQGMPIKISPK 552
            +LA +PDC   LL+E  +      + E  +L+  + + Y   V  E++R++PP F   R+A  D E  G  IP G  VL  A G  H +P+++  P +FDP RF    +    P+ YLPFG GPR C G QL  L I + + +++ ++ +      +    +       P  G+ I+I P+
Sbjct:  357 LLATNPDCQEKLLREVDDFSKKHPSPEHCSLQ--QGLPYLDMVLSETLRMYPPAFRFTREAARDCEVLGQRIPAG-TVLEVAVGALHHDPKHWPHPETFDPERFTAEAQRLQQPFTYLPFGAGPRSCLGVQLGLLEIKLTLLHILRKFRFEACPETQVPLQLESKSALSPKNGVYIRIVPR 534          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: THAS_MACFA (Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2)

HSP 1 Score: 85.1149 bits (209), Expect = 2.960e-16
Identity = 48/149 (32.21%), Postives = 77/149 (51.68%), Query Frame = 1
Query:   34 MLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDW 468
            +LA +PDC   LL+E           E  +LE+   + Y   V  E++R++PP F   R+A  D E  G  IP G  +       H +PE++  P +F+P RF    ++   P+ YLPFG GPR C G +L  L + + + +V+ ++ +
Sbjct:  356 LLATNPDCQEKLLREVDLFKEKHMVPEFCSLEE--GLPYLDMVIAETLRMYPPAFRFTREAAQDCEVLGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEAQQQHRPFTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFQF 502          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP26C_HUMAN (Cytochrome P450 26C1 OS=Homo sapiens GN=CYP26C1 PE=2 SV=2)

HSP 1 Score: 85.1149 bits (209), Expect = 2.960e-16
Identity = 50/153 (32.68%), Postives = 78/153 (50.98%), Query Frame = 1
Query:  118 LTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPE-YFEDPLSFDPRRF----EES---VPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPN-ESITMDPLPFPSQGMPIKISP 549
            L+L  + +++Y   V +E +RL PP+ G +R A+   E +G+ IPKGW V+++   TH     Y   P  FDP RF    E+S      + Y+PFGGG R C G +LA+  + +    +V    W L  P   ++   P+  P  G+ +   P
Sbjct:  358 LSLAALGRLRYVDCVVKEVLRLLPPVSGGYRTALRTFELDGYQIPKGWSVMYSIRDTHETAAVYRSPPEGFDPERFGAAREDSRGASSRFHYIPFGGGARSCLGQELAQAVLQLLAVELVRTARWELATPAFPAMQTVPIVHPVDGLRLFFHP 510          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C76A1_SOLME (Cytochrome P450 76A1 (Fragment) OS=Solanum melongena GN=CYP76A1 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 2.960e-16
Identity = 60/199 (30.15%), Postives = 95/199 (47.74%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMN-NKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSF-RKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESV-----PPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSL--------INPNESITMDPLPFPSQGMPIKISPK 552
            TTS ++      L +HP   + +  E + ++  NK+  E     D+  + Y   V +E +RL PP+     RKA+ D ++ G+ IPKG +VL  A+    +PEY+++P  F P RF ES        Y  +PFG G R+C G  L    +      ++  +DW L        IN  ES+ +       +  P+K+ PK
Sbjct:  275 TTSSSVEWALTELLRHPQAMAKVKLEILQVIGPNKKFEEC----DIDSLPYMQAVLKEQLRLHPPLPLLIPRKAIQDTKFMGYDIPKGTQVLVNAWAIGRDPEYWDNPFEFKPERFLESKVDVKGQNYELIPFGAGRRMCVGLPLGHRMMHFTFGSLLHEFDWELPHNVSPKSINMEESMGIT----ARKKQPLKVIPK 465          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4C3_DROME (Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 3.866e-16
Identity = 52/190 (27.37%), Postives = 94/190 (49.47%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF-EESVP---PYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITM--DPLPFPSQGMPIKISPK 552
            TTS AI+ T  +L  HP+    +++E  +I  + +     T++++  ++Y     ++S+RLFP +    R    D+   G  +P G + +   +  H NP  F  P  F+P  F  E+     P+ Y+PF  GPR C G + A L     +  V+ +Y    ++  E +T+  + +  P  G+ +KI+P+
Sbjct:  346 TTSAAISWTLFLLGCHPEYQERVVEELDSIFGDDKETPA-TMKNLMDMRYLECCIKDSLRLFPSVPMMARMVGEDVNIGGKIVPAGTQAIIMTYALHRNPRVFPKPEQFNPDNFLPENCAGRHPFAYIPFSAGPRNCIGQKFAILEEKAVISTVLRKYKIEAVDRREDLTLLGELILRPKDGLRVKITPR 534          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C4D20_DROME (Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 3.866e-16
Identity = 46/159 (28.93%), Postives = 79/159 (49.69%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYD 465
            TTS  ++     +A+HP+    + +E   ++    +  + T   ++ +KY   V +E+MRL+PP+    R A  ++E    TIP    +    +  H +  YF DPLSF P RF    E+    + Y+PF  GP+ C G + A L + + +  V+  Y+
Sbjct:  320 TTSSGVSHALYAIARHPEVQQRIFEELQRVLGPDASAPV-TQAQLQDLKYLDCVIKETMRLYPPVPAIGRHAQKELEIGDKTIPANTSIYLVLYYAHRDANYFPDPLSFRPERFLEDQEQGHNTFAYVPFSAGPKNCIGQKFAVLEMKVLISKVLRFYE 477          
The following BLAST results are available for this feature:
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 275
Match NameE-valueIdentityDescription
CP4V3_MOUSE1.017e-1634.27Cytochrome P450 4V3 OS=Mus musculus GN=Cyp4v3 PE=1... [more]
THAS_BOVIN1.329e-1635.14Thromboxane-A synthase OS=Bos taurus GN=TBXAS1 PE=... [more]
THAS_HUMAN1.736e-1634.46Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 P... [more]
CP26B_DANRE1.736e-1634.46Cytochrome P450 26B1 OS=Danio rerio GN=cyp26b1 PE=... [more]
THAS_PIG2.267e-1631.49Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=... [more]
THAS_MACFA2.960e-1632.21Thromboxane-A synthase OS=Macaca fascicularis GN=T... [more]
CP26C_HUMAN2.960e-1632.68Cytochrome P450 26C1 OS=Homo sapiens GN=CYP26C1 PE... [more]
C76A1_SOLME2.960e-1630.15Cytochrome P450 76A1 (Fragment) OS=Solanum melonge... [more]
CP4C3_DROME3.866e-1627.37Cytochrome P450 4c3 OS=Drosophila melanogaster GN=... [more]
C4D20_DROME3.866e-1628.93Probable cytochrome P450 4d20 OS=Drosophila melano... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00180 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00180 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623089 ID=BQ623089|Name=BQ623089|organism=Citrus sinensis|type=EST|length=604bp
ACCACATCTTTTGCCATTGCCATGACGTTTAAGATGTTAGCGCAGCATCC
AGATTGCTATTCTCTCCTCCTACAAGAACATGTTAACATAATGAATAATA
AAAGAGCTGGCGAAATTCTAACACTGGAAGACATGAAGAAGATAAAATAC
ACCTGGCAAGTTGCTCGCGAAAGCATGCGGCTCTTCCCTCCCATCTTCGG
CTCCTTCAGAAAAGCAGTTTCTGACATTGAGTATGAGGGATTCACCATTC
CTAAAGGCTGGAAGGTTTTATGGACAGCATTTGGAACACATTCGAATCCG
GAGTATTTTGAAGATCCTCTGAGTTTCGATCCCAGAAGGTTCGAGGAATC
AGTGCCTCCATATGTCTATCTTCCATTCGGAGGAGGGCCAAGATTGTGCG
CAGGCTACCAACTGGCCAAGCTAAACATCATCATCTTTGTTCATTATGTT
GTAACTCGCTATGATTGGTCTTTAATTAATCCCAACGAGTCAATCACCAT
GGATCCTCTCCCATTTCCTTCCCAAGGAATGCCCATCAAGATTTCTCCCA
AGTTGTAAACAACCAGCAATACGGCTGGGATTTTTCCTTACATAATTATG
TTGG
back to top