BQ623089

Overview
NameBQ623089
Unique NameBQ623089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C330_FUNHE (Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2)

HSP 1 Score: 82.8037 bits (203), Expect = 1.469e-15
Identity = 56/191 (29.32%), Postives = 94/191 (49.21%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNE---SITMDPLPFPSQGMPIKISPK 552
            T+S ++      LA +P+    L +E      NK       L +M+   Y   V  ES+RLFP      R A + +E  G  IPK   V+   +  H +PE + +P +F P RF    ++++ PY+Y+PFG GPR C G + A + I + V  ++ +Y +S+    E    + +  L  P + + +K+ P+
Sbjct:  308 TSSSSLTFLAYNLATNPEVMKKLQEEIDATFPNKAPVHYQPLMEME---YLDCVINESLRLFPIAARLERVAKAAVEINGVVIPKDMVVMIPTWPLHRDPEIWPEPEAFKPERFSKKNKDNIDPYIYMPFGSGPRNCIGMRFALVLIKLAVVEILQQYSFSVCKETEVPFEMDIQGLLAPKRPIQLKLVPR 495          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4FN_HUMAN (Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 2.506e-15
Identity = 50/163 (30.67%), Postives = 81/163 (49.69%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVP----PYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSL 474
            TTS  I+     LA++P+      +E   +M  +   E L  +D+ ++ +T    +ES+R +PP+    R+   DI+  +G  IPKG   L + +GTH NP  + D   ++P RF+   P    P  Y+PF  GPR C G   A   + + V   + R+  S+
Sbjct:  339 TTSSGISWMLFNLAKYPEYQEKCREEIQEVMKGRELEE-LEWDDLTQLPFTTMCIKESLRQYPPVTLVSRQCTEDIKLPDGRIIPKGIICLVSIYGTHHNPTVWPDSKVYNPYRFDPDNPQQRSPLAYVPFSAGPRNCIGQSFAMAELRVVVALTLLRFRLSV 500          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4D1_DROSI (Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 2.506e-15
Identity = 53/187 (28.34%), Postives = 85/187 (45.45%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE-----ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNES----------ITMDPLPF 516
            TTS A+   F  +A HP+      +E  +++ N ++  + + E + ++ Y     +E++R++P +    RK + D E  G  IP G  +  +        E F +P SF P RF+     E + PY Y+PF  GPR C G + A L I   V  V+  Y+   +  +             T DPL F
Sbjct:  320 TTSSALMFFFYNIATHPEAQKKCFEEIRSVVGNDKSTPV-SYELLNQLHYVDLCVKETLRMYPSVPLLGRKVLEDCEINGKLIPAGTNIGISPLYLGRREELFSEPNSFKPERFDVVTTAEKLNPYAYIPFSAGPRNCIGQKFAMLEIKAIVANVLRHYEVDFVGDSSEPPVLIAELILRTKDPLMF 505          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C12C1_DROME (Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2)

HSP 1 Score: 82.0333 bits (201), Expect = 2.506e-15
Identity = 51/167 (30.54%), Postives = 86/167 (51.50%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF-------------EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            TTS AI+     LA++P+    L +E ++ + +  +    T+EDMK + Y   V +ES+RL+P  FG+ R A +D+  +G+ IPKG K+L T      +   +     F P R+              + +  ++YLPFG GPR+C G ++  L + + V  +V  +
Sbjct:  327 TTSTAISGILLNLAKNPEKQQRLREEVLSKLTSLHSE--FTVEDMKSLPYLRAVIKESLRLYPVTFGNARSAGADVVLDGYRIPKGTKLLMTNSFLLKDDRLYPRAKEFIPERWLRRKDDDKSDVLMNKDLNAFIYLPFGFGPRMCVGKRIVDLEMELTVANLVRNF 491          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4V2_HUMAN (Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 3.273e-15
Identity = 45/143 (31.47%), Postives = 73/143 (51.05%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLA 417
            TT+ AI  +  +L  +P+    +  E  ++    ++    T+ED+KK++Y   V +E++RLFP +    R    D E  G+ + KG + +   +  H +P YF +P  F P RF     +   PY Y+PF  GPR C G + A
Sbjct:  333 TTAAAINWSLYLLGSNPEVQKKVDHELDDVFG--KSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFA 473          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4D1_DROME (Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 3.273e-15
Identity = 48/160 (30.00%), Postives = 78/160 (48.75%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE-----ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYD 465
            TTS A+   F  +A HP+      +E  +++ N ++  + + E + ++ Y     +E++R++P +    RK + D E  G  IP G  +  +        E F +P SF P RF+     E + PY Y+PF  GPR C G + A L I   V  V+  Y+
Sbjct:  320 TTSSALMFFFYNIATHPEAQKKCFEEIRSVVGNDKSTPV-SYELLNQLHYVDLCVKETLRMYPSVPLLGRKVLEDCEINGKLIPAGTNIGISPLYLGRREELFSEPNSFKPERFDVVTTAEKLNPYAYIPFSAGPRNCIGQKFAMLEIKAIVANVLRHYE 478          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP3AR_ONCMY (Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 3.273e-15
Identity = 55/175 (31.43%), Postives = 89/175 (50.86%), Query Frame = 1
Query:   70 LQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNE-SITMD--PLPFPSQGMPIKISPKL*TTSNT 573
            LQE ++ +   +A   +  E + ++ Y   V  ES+RL+P      R A   +E  G  IPK   VL   +  H +PE + DP  F P RF    +ES+ PY Y+PFG GPR C G + A + I + +  ++  + +S+ +  E  + MD   L  P + + +++  +  T SNT
Sbjct:  336 LQEEIDTVFPNKAP--IQYEALMQMDYLDCVLNESLRLYPIAPRLERVAKKTVEINGIVIPKDCIVLVPTWTLHRDPEIWSDPEEFKPERFSKENKESIDPYTYMPFGAGPRNCIGMRFALIMIKLAMVEILQSFTFSVCDETEIPLEMDNQGLLMPKRPIKLRLEARRNTPSNT 508          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4A4_RABIT (Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3)

HSP 1 Score: 81.2629 bits (199), Expect = 4.275e-15
Identity = 45/158 (28.48%), Postives = 84/158 (53.16%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF--EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYD 465
            TT+  ++  F  LA HP+      +E   ++ +   G  +T E + ++ YT    +E++RL+PP+    R+    + + +G ++PKG  +  + +G H NP+ +++P  FDP RF  + +   + +LPF GG R C G Q A   + + V   + R++
Sbjct:  325 TTASGVSWIFYALATHPEHQHRCREEIQGLLGD---GASITWEHLDQMPYTTMCIKEALRLYPPVPSVTRQLSKPVTFPDGRSLPKGVILFLSIYGLHYNPKVWQNPEVFDPFRFAPDSAYHSHAFLPFSGGARNCIGKQFAMRELKVAVALTLVRFE 479          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4E3_DROME (Cytochrome P450 4e3 OS=Drosophila melanogaster GN=Cyp4e3 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 5.583e-15
Identity = 46/156 (29.49%), Postives = 77/156 (49.36%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVP-PYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYD 465
            TT+  ++ +  +L++HPD    L +E   +M +     + + +++ K+KY     +E+ R++P +    R    D +  G  +PKG  +         N   F+DP  F P RFEE  P P+ YLPF  GPR C G + A L +   +  VV  ++
Sbjct:  311 TTTSGVSFSVYLLSRHPDVQRKLYREQCEVMGHDMNRSV-SFQEIAKMKYLDLFIKEAQRVYPSVPFIGRYCDKDYDINGSIVPKGTTLNLALILLGYNDRIFKDPHHFRPERFEEEKPAPFEYLPFSAGPRNCIGQKFALLELKTVISKVVRSFE 465          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4A6_RABIT (Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 5.583e-15
Identity = 48/158 (30.38%), Postives = 82/158 (51.90%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVP--PYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYD 465
            TT+  I+  F  LA HP+      +E   ++ +   G  +T E + ++ YT    +E++RL+PP+ G  R+  S + + +G ++PKG  V  + +  H NP+ + +P  FDP  F        + +LPF GGPR C G Q A   + + V   + R++
Sbjct:  325 TTASGISWIFYALATHPEHQHRCREEIQGLLGD---GASITWEHLDQMPYTTMCIKEALRLYPPVPGVGRQLSSPVTFPDGRSLPKGVIVTLSIYALHHNPKVWPNPEVFDPFPFAPGSARHSHAFLPFSGGPRNCIGKQFAMNELKVAVALTLVRFE 479          
The following BLAST results are available for this feature:
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 275
Match NameE-valueIdentityDescription
C330_FUNHE1.469e-1529.32Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=c... [more]
CP4FN_HUMAN2.506e-1530.67Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE... [more]
CP4D1_DROSI2.506e-1528.34Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4... [more]
C12C1_DROME2.506e-1530.54Probable cytochrome P450 12c1, mitochondrial OS=Dr... [more]
CP4V2_HUMAN3.273e-1531.47Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1... [more]
CP4D1_DROME3.273e-1530.00Cytochrome P450 4d1 OS=Drosophila melanogaster GN=... [more]
CP3AR_ONCMY3.273e-1531.43Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp... [more]
CP4A4_RABIT4.275e-1528.48Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CY... [more]
CP4E3_DROME5.583e-1529.49Cytochrome P450 4e3 OS=Drosophila melanogaster GN=... [more]
CP4A6_RABIT5.583e-1530.38Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CY... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00180 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00180 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623089 ID=BQ623089|Name=BQ623089|organism=Citrus sinensis|type=EST|length=604bp
ACCACATCTTTTGCCATTGCCATGACGTTTAAGATGTTAGCGCAGCATCC
AGATTGCTATTCTCTCCTCCTACAAGAACATGTTAACATAATGAATAATA
AAAGAGCTGGCGAAATTCTAACACTGGAAGACATGAAGAAGATAAAATAC
ACCTGGCAAGTTGCTCGCGAAAGCATGCGGCTCTTCCCTCCCATCTTCGG
CTCCTTCAGAAAAGCAGTTTCTGACATTGAGTATGAGGGATTCACCATTC
CTAAAGGCTGGAAGGTTTTATGGACAGCATTTGGAACACATTCGAATCCG
GAGTATTTTGAAGATCCTCTGAGTTTCGATCCCAGAAGGTTCGAGGAATC
AGTGCCTCCATATGTCTATCTTCCATTCGGAGGAGGGCCAAGATTGTGCG
CAGGCTACCAACTGGCCAAGCTAAACATCATCATCTTTGTTCATTATGTT
GTAACTCGCTATGATTGGTCTTTAATTAATCCCAACGAGTCAATCACCAT
GGATCCTCTCCCATTTCCTTCCCAAGGAATGCCCATCAAGATTTCTCCCA
AGTTGTAAACAACCAGCAATACGGCTGGGATTTTTCCTTACATAATTATG
TTGG
back to top