BQ623089

Overview
NameBQ623089
Unique NameBQ623089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP3AE_CAVPO (Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 1.420e-18
Identity = 51/147 (34.69%), Postives = 78/147 (53.06%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNI 429
            TTS  ++     LA HPD    L QE    + NK      T + M +++Y   V  E++RL+P      R +  D E  G + PKG  V+  +F  H + +Y+ +P  F P RF    +E++ PY+Y+PFG GPR C G ++A +N+
Sbjct:  309 TTSSTLSFIMYSLATHPDVQKKLQQEIDKTLPNKA---FPTYDVMMEMEYLDMVVNETLRLYPVTNRIERMSKKDFEINGMSFPKGTGVMIPSFALHRDSKYWPEPDEFRPERFSKKNKENIDPYIYMPFGNGPRNCIGMRMALMNL 452          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP3AH_CAVPO (Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.854e-18
Identity = 51/147 (34.69%), Postives = 77/147 (52.38%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNI 429
            TTS  +      LA HPD    L QE    + NK      T + M +++Y   V  E++RL+P      R +  D E  G + PKG  V+  +F  H + +Y+ +P  F P RF    +E++ PY+Y+PFG GPR C G ++A +N+
Sbjct:  309 TTSSTLCFIMYSLATHPDVQKKLQQEIDKTLPNKA---FPTYDVMMEMEYLDMVVNETLRLYPVTNRIERMSKKDFEINGMSFPKGTGVMIPSFALHRDSKYWPEPDEFRPERFSKKNKENIDPYIYMPFGNGPRNCIGMRMALMNL 452          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP3AG_MOUSE (Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.854e-18
Identity = 57/191 (29.84%), Postives = 96/191 (50.26%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEE----SVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNE---SITMDPLPFPSQGMPIKISPK 552
            TTS  ++ T   LA HPD    L +E    + NK      T + +  ++Y   V  E++RL+P      R    D+E  G  IPKG  V+  ++  H +P+++ +P  F P RF +    S+ PYVYLPFG GPR C G + A +N+ + +  V+  + +      +    ++ + L  P + + +K+ P+
Sbjct:  310 TTSSILSFTVYSLATHPDIQKKLQEEIDEALPNKAPP---TYDTVMAMEYLDMVLNETLRLYPITNRLQRVCKKDVEINGIYIPKGSTVIIPSYVLHHDPQHWPEPEEFQPERFSKENKGSIDPYVYLPFGNGPRNCIGMRFALMNMKLALIKVLQNFSFQPCKETQIPLKLSRELLLQPVKPIVLKVVPR 497          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP343_HUMAN (Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.854e-18
Identity = 59/190 (31.05%), Postives = 91/190 (47.89%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNE-SITMDPLPFPSQGMPIKISPKL 555
            TTS  +      LA HPD    L +E   ++ NK     +T + + +++Y   V  E++RLFP +    R    DIE  G  IPKG  V+   +  H +P+Y+ +P  F P RF    ++S+  Y Y+PFG GPR C G + A  NI + V   +  + +      +  + +D LP      PI +   L
Sbjct:  309 TTSTTLPFIMYELATHPDVQQKLQEEIDAVLPNKAP---VTYDALVQMEYLDMVVNETLRLFPVVSRVTRVCKKDIEINGVFIPKGLAVMVPIYALHHDPKYWTEPEKFCPERFSKKNKDSIDLYRYIPFGAGPRNCIGMRFALTNIKLAVIRALQNFSFKPCKETQIPLKLDNLPILQPEKPIVLKVHL 495          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP26B_HUMAN (Cytochrome P450 26B1 OS=Homo sapiens GN=CYP26B1 PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.854e-18
Identity = 63/190 (33.16%), Postives = 91/190 (47.89%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLL---LQEHVNIMNNKRAGE-ILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF-----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPN-ESITMDPLPFPSQGMPIK 540
            TT+ A       L +HP     L   L+ H  + +     E  L L+ +  ++Y   V +E MRLF PI G +R  +   E +GF IPKGW V+++   TH     F+D   FDP RF     E+    + YLPFGGG R C G  LAKL + +    + +   + L       IT+ P+  P  G+ +K
Sbjct:  300 TTASASTSLIMQLLKHPTVLEKLRDELRAHGILHSGGCPCEGTLRLDTLSGLRYLDCVIKEVMRLFTPISGGYRTVLQTFELDGFQIPKGWSVMYSIRDTHDTAPVFKDVNVFDPDRFSQARSEDKDGRFHYLPFGGGVRTCLGKHLAKLFLKVLAVELASTSRFELATRTFPRITLVPVLHPVDGLSVK 489          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP3AO_SHEEP (Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 2.422e-18
Identity = 59/181 (32.60%), Postives = 89/181 (49.17%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGM 531
            TTS  ++    +LA HPD    L +E      NK      T + + +++Y   V  E++R+FP      R    D+E  G +IPKG  V    F  H +P+ + +P  F P RF    ++S+ PYVYLPFG GPR C G + A +N+ + +  V+  + +         T  PL   SQG+
Sbjct:  309 TTSNTLSFLLYILATHPDVQQKLQEEIDATFPNKAPP---TYDVLAQMEYLDMVVNETLRMFPIAVRLDRLCKKDVEIHGVSIPKGTAVTVPIFVLHRDPQLWPEPEEFRPERFSKKNKDSINPYVYLPFGTGPRNCIGMRFAIMNMKLAIVRVLQNFSFKPCKE----TQIPLKINSQGL 482          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP3A8_MACFA (Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 2.422e-18
Identity = 50/160 (31.25%), Postives = 83/160 (51.88%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDW 468
            TTS  ++     LA HPD    L +E   ++ NK      T + + +++Y   V  E++R+FP      R    D+E  G  IPKG  V+  ++  H +P+Y+ +P  F P RF     +++ PY+Y PFG GPR C G + A +N+ + +  V+  + +
Sbjct:  309 TTSSVLSFIIYELATHPDVQQKLQEEIDTVLPNKAPP---TYDTVLQMEYLDMVVNETLRIFPIAMRLERVCKKDVEINGIFIPKGVVVMIPSYALHHDPKYWPEPEKFLPERFSKKNNDNIDPYIYTPFGSGPRNCIGMRFALMNMKLAIIRVLQNFSF 465          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP3A4_HUMAN (Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4)

HSP 1 Score: 91.6633 bits (226), Expect = 3.163e-18
Identity = 51/160 (31.87%), Postives = 84/160 (52.50%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDW 468
            TTS  ++     LA HPD    L +E   ++ NK      T + + +++Y   V  E++RLFP      R    D+E  G  IPKG  V+  ++  H +P+Y+ +P  F P RF    ++++ PY+Y PFG GPR C G + A +N+ + +  V+  + +
Sbjct:  309 TTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPP---TYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSF 465          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP46A_HUMAN (Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP46A1 PE=1 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 4.131e-18
Identity = 53/177 (29.94%), Postives = 93/177 (52.54%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPP--YVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLI-----NPNESITMDPL 510
            T++  +A T   L++ P+  + L  E   ++ +KR    L  ED+ +++Y  QV +ES+RL+PP +G+FR    +   +G  +P    +L++ +       YFEDPL+F+P RF    P   + Y PF  G R C G Q A++ + + +  ++ R ++ L+        E  T+ PL
Sbjct:  306 TSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKR---YLDFEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQRFGLQEQATLKPL 479          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP3AT_PIG (Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 5.395e-18
Identity = 59/196 (30.10%), Postives = 96/196 (48.98%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNE---SITMDPLPFPSQGMPIKISPKL*TTS 567
            TTS A+++    LA HPD    L +E      NK      T + + +++Y   V  E++RL+P      R    D+E  G  +PKG  V+   F  H +P+ + +P  F P RF    ++++ PY YLPFG GPR C G + A +N+ + +  V+  + +      +    +T   L  P + + +KI P+  T S
Sbjct:  309 TTSSALSLLAYELATHPDVQQKLQEEIEATFPNKAPP---TYDALAQMEYLDMVVNETLRLYPIAARLERACKKDVEIHGVFVPKGTVVVVPVFVLHRDPDLWPEPEEFRPERFSKKHKDTINPYTYLPFGTGPRNCIGMRFALMNMKLALVRVLQNFSFKPCKETQIPLKLTTQGLTQPEKPVVLKILPRDGTVS 501          
The following BLAST results are available for this feature:
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 275
Match NameE-valueIdentityDescription
CP3AE_CAVPO1.420e-1834.69Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14... [more]
CP3AH_CAVPO1.854e-1834.69Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17... [more]
CP3AG_MOUSE1.854e-1829.84Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE... [more]
CP343_HUMAN1.854e-1831.05Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE... [more]
CP26B_HUMAN1.854e-1833.16Cytochrome P450 26B1 OS=Homo sapiens GN=CYP26B1 PE... [more]
CP3AO_SHEEP2.422e-1832.60Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2... [more]
CP3A8_MACFA2.422e-1831.25Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3... [more]
CP3A4_HUMAN3.163e-1831.88Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1... [more]
CP46A_HUMAN4.131e-1829.94Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP4... [more]
CP3AT_PIG5.395e-1830.10Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00180 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00180 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623089 ID=BQ623089|Name=BQ623089|organism=Citrus sinensis|type=EST|length=604bp
ACCACATCTTTTGCCATTGCCATGACGTTTAAGATGTTAGCGCAGCATCC
AGATTGCTATTCTCTCCTCCTACAAGAACATGTTAACATAATGAATAATA
AAAGAGCTGGCGAAATTCTAACACTGGAAGACATGAAGAAGATAAAATAC
ACCTGGCAAGTTGCTCGCGAAAGCATGCGGCTCTTCCCTCCCATCTTCGG
CTCCTTCAGAAAAGCAGTTTCTGACATTGAGTATGAGGGATTCACCATTC
CTAAAGGCTGGAAGGTTTTATGGACAGCATTTGGAACACATTCGAATCCG
GAGTATTTTGAAGATCCTCTGAGTTTCGATCCCAGAAGGTTCGAGGAATC
AGTGCCTCCATATGTCTATCTTCCATTCGGAGGAGGGCCAAGATTGTGCG
CAGGCTACCAACTGGCCAAGCTAAACATCATCATCTTTGTTCATTATGTT
GTAACTCGCTATGATTGGTCTTTAATTAATCCCAACGAGTCAATCACCAT
GGATCCTCTCCCATTTCCTTCCCAAGGAATGCCCATCAAGATTTCTCCCA
AGTTGTAAACAACCAGCAATACGGCTGGGATTTTTCCTTACATAATTATG
TTGG
back to top