BQ623089

Overview
NameBQ623089
Unique NameBQ623089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: ERG5_SCHPO (Cytochrome P450 61 OS=Schizosaccharomyces pombe GN=erg5 PE=1 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 1.520e-12
Identity = 55/192 (28.65%), Postives = 93/192 (48.44%), Query Frame = 1
Query:    4 TSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEI---LTLEDMKKIKYTWQVARESMRLFPPIFG-SFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEES----VPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESIT--MDPLPFPSQGMPIKISP 549
            TS A+   F++LA HPD    + +E + I    R G+I   L+L+ M+K+ YT  V +E +RL PP+    +R   +      +T+PK   V+ T +G   + + + +P +F+P R+  +      P  ++ FG GP +C G + A  ++I  +       DW      +S T  +    FP     +K SP
Sbjct:  324 TSSAMTWLFQLLADHPDVLQKVREEQLRI----RKGDIDVPLSLDLMEKMTYTRAVVKECLRLRPPVLMVPYRVKKAFPITPDYTVPKDAMVIPTLYGALHDSKVYPEPETFNPDRWAPNGLAEQSPKNWMVFGNGPHVCLGQRYAVNHLIACIGKASIMLDWKHKRTPDSDTQMIFATTFPQDMCYLKFSP 511          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP9H1_DROME (Probable cytochrome P450 9h1 OS=Drosophila melanogaster GN=Cyp9h1 PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.520e-12
Identity = 43/139 (30.94%), Postives = 74/139 (53.24%), Query Frame = 1
Query:   70 LQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIE------YEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEE--SVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            L E +  ++ +  G+ LT + + K+KY   V  E++R +PP   + R+   DI+       + F+  KG  +    F  H +PE FEDP  F+P RF +  ++   VY+PFG GPR C G ++A + +   V+ ++  +
Sbjct:  345 LYEEIISVHEELKGQPLTYDKLTKMKYLDMVVLEALRKWPPSISTDRECRQDIDLFDENGQKLFSARKGDVLQIPIFSLHHDPENFEDPEFFNPERFADGHALESRVYMPFGVGPRNCIGNRMALMELKSIVYQLLLNF 483          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP19A_HORSE (Cytochrome P450 19A1 OS=Equus caballus GN=CYP19A1 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.520e-12
Identity = 46/162 (28.40%), Postives = 77/162 (47.53%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPN 486
            T S  +     ++AQHP     L++E   ++  +     L  +DM+K+K       ESMR  P +    RKA+ D   +G+ + KG  ++    G     E+F  P  F    FE++VP   + PFG GPR CAG  +A + + + +  ++ R+    +  N
Sbjct:  310 TLSVTVFFMLCLIAQHPKVEEALMKEIQTVLGERD----LKNDDMQKLKVMENFINESMRYQPVVDIVMRKALEDDVIDGYPVKKGTNIILN-IGRMHKLEFFPKPNEFTLENFEKNVPYRYFQPFGFGPRSCAGKFIAMVMMKVMLVSLLRRFHVKTLQGN 466          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP6B2_HELAM (Cytochrome P450 6B2 OS=Helicoverpa armigera GN=CYP6B2 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.986e-12
Identity = 55/194 (28.35%), Postives = 99/194 (51.03%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEG--FTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRR-FEESV---PPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWS-LINPNESITMDPLPF---PSQGMPIKISPK 552
            T++  +A     LA +PD  + L+ E    +  K  G  +T + +K +KY  +V  E++R++  +    RKA+ D +  G    I K   VL +  G H +P+Y+++P  F+P R F E V    P  YLPFG G R C G +  +L  ++ +  +++++      N + ++ ++P  F   P  G+ + I P+
Sbjct:  309 TSATTMAYLTYQLALNPDIQNKLIAEIDEAI--KANGGKVTYDTVKDMKYLNKVFDETLRMYSIVEPLQRKAIRDYKLPGTDVVIEKDTVVLISPRGIHYDPKYYDNPKQFNPERFFAEEVGKRHPCAYLPFGLGQRNCIGMRFGRLQSLLCITKLLSKFRLEPSKNTDRNLQVEPYRFIIGPKGGIRLNIVPR 500          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP52E_CANMA (Cytochrome P450 52A5 OS=Candida maltosa GN=CYP52A5 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.986e-12
Identity = 53/169 (31.36%), Postives = 83/169 (49.11%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQE---HVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY---------EGFTIPKGWKVLWTAFGTHSNPEYF-EDPLSFDPRR-FEESVPP--YVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTR 459
            TT+  ++     LA++P  ++ L +E   +  +    R  EI + E +KK +Y   V  E++R++P +  +FR A  D                +PKG  V++T + TH   EY+ +D   F P R FE S     + Y+PF GGPR+C G Q A    +    YV+TR
Sbjct:  324 TTAGLLSFAMFELARNPKIWNKLREEIEVNFGLGEEARVDEI-SFETLKKCEYLKAVLNETLRMYPSVPVNFRTATRDTTLPRGGGKDGTSPIFVPKGSSVVYTVYKTHRLEEYYGKDAYEFRPERWFEPSTRKLGWAYVPFNGGPRICLGQQFA----LTEASYVITR 487          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP51_MYCVP (Lanosterol 14-alpha demethylase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=cyp51 PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.986e-12
Identity = 46/173 (26.59%), Postives = 84/173 (48.55%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF-----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMD 504
            T+S   + T   L +HP+ Y+ + QE  ++  +   G+ ++   +++I       +E++RL PP+    R A  + E  G+ I KG  V  +   ++  PE F +P  FDP R+     E+ +  + ++PFG G   C G   A++ I      ++  Y++ +  P ES   D
Sbjct:  261 TSSGTSSWTLIELLRHPEFYAKVQQELDDLYAD---GQEVSFHALRQIPSLDNALKETLRLHPPLIILMRVAQDEFEVAGYPIHKGQMVAASPAISNRIPEDFPNPDDFDPDRYEKPRQEDLINRWTWIPFGAGKHRCVGAAFAQMQIKAIFSVLLREYEFEMAQPPESYQND 430          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4FC_HUMAN (Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.986e-12
Identity = 45/152 (29.61%), Postives = 75/152 (49.34%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE----ESVPPYVYLPFGGGPRLCAG--YQLAKLNIII 435
            TT+  ++     LA+HP+      QE   ++ ++   EI   +D+ ++ +     +ES+RL PP     R    DI   +G  IPKG   L    G H NP  + DP  +DP RF+    +   P  ++PF  GPR C G  + +A++ +++
Sbjct:  332 TTASGLSWVLYNLARHPEYQERCRQEVQELLKDRDPKEI-EWDDLAQLPFLTMCVKESLRLHPPAPFISRCCTQDIVLPDGRVIPKGITCLIDIIGVHHNPTVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVVL 482          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C71DF_MENPI (Cytochrome P450 71D15 OS=Mentha piperita GN=CYP71D15 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.986e-12
Identity = 37/132 (28.03%), Postives = 68/132 (51.52%), Query Frame = 1
Query:  124 LEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYV-----YLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMD 504
            ++D++++KY   V +E+MR+ PPI    R    +    G+TIP   +++   +    NP Y+E P +F P RF++    ++     ++PFG G R+C G      N+ + +  ++  +DW L    +   MD
Sbjct:  341 VDDVQELKYMKSVVKETMRMHPPIPLIPRSCREECVVNGYTIPNKARIMINVWSMGRNPLYWEKPDTFWPERFDQVSKDFMGNDFEFVPFGAGRRICPGLNFGLANVEVPLAQLLYHFDWKLAEGMKPSDMD 472          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C71BL_ARATH (Cytochrome P450 71B21 OS=Arabidopsis thaliana GN=CYP71B21 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.986e-12
Identity = 49/162 (30.25%), Postives = 81/162 (50.00%), Query Frame = 1
Query:   13 AIAMTFKM--LAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSF-RKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPY-----VYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSL 474
            AI M + +  L +HP     L QE   ++ + +  E +T +D++K+ Y   V +E+ RL PP      R+ +SD++ +G+ IPK   +    +    +P  + +P  F P RF +S   Y       LPFGGG R+C G       + + +  V+  +DWSL
Sbjct:  307 AITMIWALTELTRHPRVMKKLQQEIRELLGDNK--EKITEQDLEKVHYLKLVIQETFRLHPPAPLLLPRETMSDVKIQGYNIPKNTMIEINTYAIGRDPNCWTNPNEFIPERFVDSPIDYKGQHFELLPFGGGRRICPGMATGMTIVELGLLNVLYFFDWSL 466          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C4D10_DROMT (Cytochrome P450 4d10 OS=Drosophila mettleri GN=Cyp4d10 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.986e-12
Identity = 51/187 (27.27%), Postives = 85/187 (45.45%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE-----ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLI-NPNES---------ITMDPLPF 516
            TTS  I   F  +A +P+C    ++E V+++  K     +T + +  + Y     +E++R++P +    RK + + E  G  IP G  +  +      + +   +P +F P RF+     E + P+ Y+PF  GPR C G + A L I      V+  Y+   + N  ES          T DPL F
Sbjct:  321 TTSSGITFFFYNIALYPECQRKCVEEIVSVLG-KDTETPVTYDLLNNLNYMDLCIKETLRMYPSVPLLGRKVLQECEINGKIIPAGTNIGISPLFLGRSEDISSEPNTFKPERFDVVTSAEKLNPHAYIPFSAGPRNCIGQKFAMLEIKAIAANVLRHYEIEFVGNAEESPVLIAELILRTKDPLMF 506          
The following BLAST results are available for this feature:
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 275
Match NameE-valueIdentityDescription
ERG5_SCHPO1.520e-1228.65Cytochrome P450 61 OS=Schizosaccharomyces pombe GN... [more]
CP9H1_DROME1.520e-1230.94Probable cytochrome P450 9h1 OS=Drosophila melanog... [more]
CP19A_HORSE1.520e-1228.40Cytochrome P450 19A1 OS=Equus caballus GN=CYP19A1 ... [more]
CP6B2_HELAM1.986e-1228.35Cytochrome P450 6B2 OS=Helicoverpa armigera GN=CYP... [more]
CP52E_CANMA1.986e-1231.36Cytochrome P450 52A5 OS=Candida maltosa GN=CYP52A5... [more]
CP51_MYCVP1.986e-1226.59Lanosterol 14-alpha demethylase OS=Mycobacterium v... [more]
CP4FC_HUMAN1.986e-1229.61Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE... [more]
C71DF_MENPI1.986e-1228.03Cytochrome P450 71D15 OS=Mentha piperita GN=CYP71D... [more]
C71BL_ARATH1.986e-1230.25Cytochrome P450 71B21 OS=Arabidopsis thaliana GN=C... [more]
C4D10_DROMT1.986e-1227.27Cytochrome P450 4d10 OS=Drosophila mettleri GN=Cyp... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00180 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00180 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623089 ID=BQ623089|Name=BQ623089|organism=Citrus sinensis|type=EST|length=604bp
ACCACATCTTTTGCCATTGCCATGACGTTTAAGATGTTAGCGCAGCATCC
AGATTGCTATTCTCTCCTCCTACAAGAACATGTTAACATAATGAATAATA
AAAGAGCTGGCGAAATTCTAACACTGGAAGACATGAAGAAGATAAAATAC
ACCTGGCAAGTTGCTCGCGAAAGCATGCGGCTCTTCCCTCCCATCTTCGG
CTCCTTCAGAAAAGCAGTTTCTGACATTGAGTATGAGGGATTCACCATTC
CTAAAGGCTGGAAGGTTTTATGGACAGCATTTGGAACACATTCGAATCCG
GAGTATTTTGAAGATCCTCTGAGTTTCGATCCCAGAAGGTTCGAGGAATC
AGTGCCTCCATATGTCTATCTTCCATTCGGAGGAGGGCCAAGATTGTGCG
CAGGCTACCAACTGGCCAAGCTAAACATCATCATCTTTGTTCATTATGTT
GTAACTCGCTATGATTGGTCTTTAATTAATCCCAACGAGTCAATCACCAT
GGATCCTCTCCCATTTCCTTCCCAAGGAATGCCCATCAAGATTTCTCCCA
AGTTGTAAACAACCAGCAATACGGCTGGGATTTTTCCTTACATAATTATG
TTGG
back to top