BQ623089

Overview
NameBQ623089
Unique NameBQ623089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C84A1_ARATH (Cytochrome P450 84A1 OS=Arabidopsis thaliana GN=CYP84A1 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 3.387e-12
Identity = 47/164 (28.66%), Postives = 76/164 (46.34%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPP------YVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSL 474
            T + AI      L + P+    + QE   ++   R  E     D++K+ Y     +E++R+ PPI     +   D   +GF IPK  +V+  AF    +P  + DP +F P RF E   P      + ++PFG G R C G QL    + + V +++  + W L
Sbjct:  323 TVASAIEWALTELLRSPEDLKRVQQELAEVVGLDRRVEE---SDIEKLTYLKCTLKETLRMHPPIPLLLHETAEDTSIDGFFIPKKSRVMINAFAIGRDPTSWTDPDTFRPSRFLEPGVPDFKGSNFEFIPFGSGRRSCPGMQLGLYALDLAVAHILHCFTWKL 483          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C11B1_CAVPO (Cytochrome P450 11B1, mitochondrial OS=Cavia porcellus GN=CYP11B1 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 3.387e-12
Identity = 46/158 (29.11%), Postives = 79/158 (50.00%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHV----NIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            TT+  + MT   LA++P     L QE +    NI  N +    L +E    +   W   +E++R++P      R   S +  + + IP G  V    +    NPE F  P  ++P+R+ E+   Y +L FG G R C G +LA++ +++F+H+V+  +
Sbjct:  318 TTALPLMMTLFELARNPTVQQALRQESMATEPNIYENPQR---LRME----LPLLWAAIKETLRMYPVGLFLERFLTSPLVLQNYHIPAGTLVHLNLYSMGRNPEVFLSPEHYNPQRWLENKETYKHLAFGFGVRQCIGRRLAEVEMLLFLHHVLKSF 468          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP51_DICDI (Probable lanosterol 14-alpha demethylase OS=Dictyostelium discoideum GN=cyp51 PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 4.424e-12
Identity = 48/185 (25.95%), Postives = 90/185 (48.65%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE-ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKISPK 552
            T+S  +  T   L  + + +    ++  +I+  +  GEI   + +K++     V RE +RL PP+    RK ++ +EY+G TIP G  +  +       P  +++P SF+P+RF+ E   P+ ++ FGGG   C G     L I         +  W++++   ++ + P+P P+    +   PK
Sbjct:  281 TSSITLTYTIFYLLNNLEYFDETQKDINDIVQKENQGEI-NFDGLKRMNRLETVIREVLRLHPPLIFLMRKVMTPMEYKGKTIPAGHILAVSPQVGMRLPTVYKNPDSFEPKRFDVEDKTPFSFIAFGGGKHGCPGENFGILQI---------KTIWTVLSTKYNLEVGPVP-PTDFTSLVAGPK 454          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4FB_HUMAN (Cytochrome P450 4F11 OS=Homo sapiens GN=CYP4F11 PE=2 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 4.424e-12
Identity = 45/152 (29.61%), Postives = 77/152 (50.66%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF-EESV---PPYVYLPFGGGPRLCAG--YQLAKLNIII 435
            TT+  ++     LA+HP+      QE   ++ ++   EI   +D+ ++ +     +ES+RL PP+    R    D    +G  IPKG   L    G H NP  + DP  +DP RF +E++    P  ++PF  GPR C G  + +A++ +++
Sbjct:  332 TTASGLSWVLYHLAKHPEYQEQCRQEVQELLKDREPIEI-EWDDLAQLPFLTMCIKESLRLHPPVPVISRCCTQDFVLPDGRVIPKGIVCLINIIGIHYNPTVWPDPEVYDPFRFNQENIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVL 482          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C98A1_SORBI (Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 4.424e-12
Identity = 45/164 (27.44%), Postives = 81/164 (49.39%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSF-RKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF-EESV----PPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSL 474
            TT  ++      L ++P     L +E   ++   R   ++   D + + Y   V +ES+RL PP       KA ++++  G+ IPKG  V+   +    +P+ + +PL + P RF EE++      +  LPFG G R+C G QL    +   + +++  ++WSL
Sbjct:  306 TTVISVEWAMAELVRNPRVQKKLQEELDRVVGRDR---VMLETDFQNLPYLQAVVKESLRLHPPTPLMLPHKASTNVKIGGYDIPKGANVMVNVWAVARDPKVWSNPLEYRPERFLEENIDIKGSDFRVLPFGAGRRVCPGAQLGINLVASMIGHLLHHFEWSL 466          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C12A4_DROME (Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=1 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 4.424e-12
Identity = 47/179 (26.26%), Postives = 78/179 (43.58%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF---------------EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNES 492
            TTS         LA++P+  + L +E + ++ NK +    T   MK + Y     +ES RL P I G+ R    D    G+ +P G  V        +  EYF     F P R+                +S  P+V+LPFG GPR+C G ++ ++ + +    ++  ++     P E+
Sbjct:  337 TTSSTFTALLLCLAKNPEKQARLREEVMKVLPNKNSE--FTEASMKNVPYLRACIKESQRLHPLIVGNARVLARDAVLSGYRVPAGTYVNIVPLNALTRDEYFPQASEFLPERWLRSPKDSESKCPANELKSTNPFVFLPFGFGPRMCVGKRIVEMELELGTARLIRNFNVEFNYPTEN 513          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP51_CANTR (Lanosterol 14-alpha demethylase OS=Candida tropicalis GN=ERG11 PE=3 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 5.778e-12
Identity = 50/174 (28.74%), Postives = 79/174 (45.40%), Query Frame = 1
Query:   37 LAQHPDCYSLLLQEHVNIMNNKRAGEI--LTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEG--FTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE-------------ESVPPY-----------VYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSL 474
            LA+ P     L +E  N++  K  G++  LT ED++K+       +E++R+  P+   FRK ++ +      + IPKG  VL +A   H++  +FE P  F+PRR+E             E    Y            YLPFGGG   C G Q A + +   +   +  + W L
Sbjct:  323 LAEQPQLQDDLYEELTNLLKEK-GGDLNDLTYEDLQKLPLVNNTIKETLRMHMPLHSIFRKVMNPLRVPNTKYVIPKGHYVLVSAGYAHTSDRWFEHPEHFNPRRWESDDTKASAVSFNSEDTVDYGFGKISKGVSSPYLPFGGGRHRCIGEQFAYVQLGTILTTYIYNFKWRL 495          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4F8_HUMAN (Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 5.778e-12
Identity = 44/159 (27.67%), Postives = 74/159 (46.54%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE----ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            TT+  ++     LA+HP+      QE   ++ ++   EI   +D+ ++ +     +ES+RL PPI    R    D+   +   IPKG       F  H NP  + DP  +DP RF+    +   P  ++PF  GPR C G + A   + + +   + R+
Sbjct:  332 TTASGLSWVLYNLARHPEYQERCRQEVQELLKDREPKEI-EWDDLAQLPFLTMCLKESLRLHPPIPTFARGCTQDVVLPDSRVIPKGNVCNINIFAIHHNPSVWPDPEVYDPFRFDPENAQKRSPMAFIPFSAGPRNCIGQKFAMAEMKVVLALTLLRF 489          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4B1_RABIT (Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 5.778e-12
Identity = 46/178 (25.84%), Postives = 81/178 (45.51%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVP----PYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFP 519
            TT+  I+     +A +P+      +E   I+ ++   +    ED+ K+ Y     +E  RL+PP+   +R+    + + +G ++P G  +    +  H N + + DP  FDP RF         PY ++PF  GPR C G Q A   + +     + R+++S         +DPL  P
Sbjct:  314 TTTSGISWFLYCMALYPEHQQRCREEVREILGDQ---DSFQWEDLAKMTYLTMCMKECFRLYPPVPQVYRQLSKPVSFVDGRSLPAGSLISLHIYALHRNSDVWPDPEVFDPLRFSPENSSGRHPYAFIPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFS---------VDPLRLP 479          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP19A_SHEEP (Cytochrome P450 19A1 OS=Ovis aries GN=CYP19A1 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 5.778e-12
Identity = 41/154 (26.62%), Postives = 76/154 (49.35%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            T S ++     ++A+HP     +++E   ++  +     + ++DM+K+K       ESMR  P +    RKA+ D   +G+ + KG  ++    G     E+F  P  F    F ++VP   + PFG GPR CAG  +A + + + +  ++ R+
Sbjct:  310 TMSVSVFFMLFLIAKHPQVEEAMMREIQTVVGERD----IRIDDMQKLKVVENFINESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILN-LGRMHRLEFFPKPNEFTLENFAKNVPYRYFQPFGFGPRACAGKYIAMVMMKVILVTLLRRF 458          
The following BLAST results are available for this feature:
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 275
Match NameE-valueIdentityDescription
C84A1_ARATH3.387e-1228.66Cytochrome P450 84A1 OS=Arabidopsis thaliana GN=CY... [more]
C11B1_CAVPO3.387e-1229.11Cytochrome P450 11B1, mitochondrial OS=Cavia porce... [more]
CP51_DICDI4.424e-1225.95Probable lanosterol 14-alpha demethylase OS=Dictyo... [more]
CP4FB_HUMAN4.424e-1229.61Cytochrome P450 4F11 OS=Homo sapiens GN=CYP4F11 PE... [more]
C98A1_SORBI4.424e-1227.44Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1... [more]
C12A4_DROME4.424e-1226.26Probable cytochrome P450 12a4, mitochondrial OS=Dr... [more]
CP51_CANTR5.778e-1228.74Lanosterol 14-alpha demethylase OS=Candida tropica... [more]
CP4F8_HUMAN5.778e-1227.67Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1... [more]
CP4B1_RABIT5.778e-1225.84Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CY... [more]
CP19A_SHEEP5.778e-1226.62Cytochrome P450 19A1 OS=Ovis aries GN=CYP19A1 PE=2... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00180 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00180 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623089 ID=BQ623089|Name=BQ623089|organism=Citrus sinensis|type=EST|length=604bp
ACCACATCTTTTGCCATTGCCATGACGTTTAAGATGTTAGCGCAGCATCC
AGATTGCTATTCTCTCCTCCTACAAGAACATGTTAACATAATGAATAATA
AAAGAGCTGGCGAAATTCTAACACTGGAAGACATGAAGAAGATAAAATAC
ACCTGGCAAGTTGCTCGCGAAAGCATGCGGCTCTTCCCTCCCATCTTCGG
CTCCTTCAGAAAAGCAGTTTCTGACATTGAGTATGAGGGATTCACCATTC
CTAAAGGCTGGAAGGTTTTATGGACAGCATTTGGAACACATTCGAATCCG
GAGTATTTTGAAGATCCTCTGAGTTTCGATCCCAGAAGGTTCGAGGAATC
AGTGCCTCCATATGTCTATCTTCCATTCGGAGGAGGGCCAAGATTGTGCG
CAGGCTACCAACTGGCCAAGCTAAACATCATCATCTTTGTTCATTATGTT
GTAACTCGCTATGATTGGTCTTTAATTAATCCCAACGAGTCAATCACCAT
GGATCCTCTCCCATTTCCTTCCCAAGGAATGCCCATCAAGATTTCTCCCA
AGTTGTAAACAACCAGCAATACGGCTGGGATTTTTCCTTACATAATTATG
TTGG
back to top