BQ623089

Overview
NameBQ623089
Unique NameBQ623089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP19A_CAPHI (Cytochrome P450 19A1 OS=Capra hircus GN=CYP19A1 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 5.778e-12
Identity = 41/154 (26.62%), Postives = 76/154 (49.35%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            T S ++     ++A+HP     +++E   ++  +     + ++DM+K+K       ESMR  P +    RKA+ D   +G+ + KG  ++    G     E+F  P  F    F ++VP   + PFG GPR CAG  +A + + + +  ++ R+
Sbjct:  310 TMSVSVFFMLFLIAKHPQVEEAMMREIQTVVGERD----IRIDDMQKLKVVENFINESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILN-LGRMHRLEFFPKPNEFTLENFAKNVPYRYFQPFGFGPRACAGKYIAMVMMKVILVTLLRRF 458          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP192_CARAU (Cytochrome P450 19 type 2 OS=Carassius auratus GN=cyp19a2 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 5.778e-12
Identity = 47/171 (27.49%), Postives = 78/171 (45.61%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLP 513
            T S ++     +L Q+PD    +LQE    MN   AG  L    +           ES+R  P +  + R+A+ D   EG+ + +G  ++      H + E+F  P  F    F+++VP   + PFG GPR C G  +A   +++    +VT      + P +  T+D +P
Sbjct:  330 TLSISLFFMLLLLKQNPDVELKILQE----MNAVLAGRSLQHSHLSGFHILESFINESLRFHPVVDFTMRRALDDDVIEGYKVKRGTNIILNVGRMHRS-EFFPKPNEFSLDNFQKNVPSRFFQPFGSGPRSCVGKHMA---MVMMKSILVTLLSRFSVCPVKGCTVDSIP 492          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP138_MYCTU (Putative cytochrome P450 138 OS=Mycobacterium tuberculosis GN=cyp138 PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 5.778e-12
Identity = 40/155 (25.81%), Postives = 77/155 (49.68%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVP-PYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            TT+  +   F+ L++HPD  + L++E  N  +  R   IL ++  + +     +   + R+ PP++          +   + IP+G+ ++      H +P+ F  P  FDP+R+  S P P+ ++PFGGG R C G   A + + + +  V+  +
Sbjct:  270 TTAATLGWAFERLSRHPDVLAALVEEVDNGGHELRQAAILEVQRARTV-----IDFAARRVNPPVY----------QLGEWVIPRGYSIIINIAQIHGDPDVFPQPDRFDPQRYIGSKPSPFAWIPFGGGTRRCVGAAFANMEMDVVLRTVLRHF 409          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP138_MYCBO (Putative cytochrome P450 138 OS=Mycobacterium bovis GN=cyp138 PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 5.778e-12
Identity = 40/155 (25.81%), Postives = 77/155 (49.68%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVP-PYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            TT+  +   F+ L++HPD  + L++E  N  +  R   IL ++  + +     +   + R+ PP++          +   + IP+G+ ++      H +P+ F  P  FDP+R+  S P P+ ++PFGGG R C G   A + + + +  V+  +
Sbjct:  270 TTAATLGWAFERLSRHPDVLAALVEEVDNGGHELRQAAILEVQRARTV-----IDFAARRVNPPVY----------QLGEWVIPRGYSIIINIAQIHGDPDVFPQPDRFDPQRYIGSKPSPFAWIPFGGGTRRCVGAAFANMEMDVVLRTVLRHF 409          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C71B3_ARATH (Cytochrome P450 71B3 OS=Arabidopsis thaliana GN=CYP71B3 PE=2 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 5.778e-12
Identity = 43/150 (28.67%), Postives = 76/150 (50.67%), Query Frame = 1
Query:   73 QEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSF-RKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPY-----VYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMD 504
            QE +      +  E +  ED+ K++Y   V +E++RL PP      R+ ++DI+ +G+ IP+   +L  A+    NPE +E+P  F+P RF +    Y       LPFG G ++C G       + + +  ++  +DW L   ++ I M+
Sbjct:  331 QEEIRTCIGIKQKERIEEEDVDKLQYLKLVIKETLRLHPPAPLLLPRETMADIKIQGYDIPRKTILLVNAWSIGRNPELWENPEEFNPERFIDCPMDYKGNSFEMLPFGSGRKICPGIAFGIATVELGLLNLLYYFDWRLAEEDKDIDME 480          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C12A5_DROME (Probable cytochrome P450 12a5, mitochondrial OS=Drosophila melanogaster GN=Cyp12a5 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 5.778e-12
Identity = 43/158 (27.22%), Postives = 72/158 (45.57%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVP---------------PYVYLPFGGGPRLCAGYQLAKLNI 429
            TTS         LA++P+  + L +E + ++ NK +    T   MK + Y     +ES R++P + G+ R    D    G+ +P G  V      +  + EYF  P  F P R+  +                 P+V+LPFG GPR+C G ++ ++ +
Sbjct:  337 TTSSTFTALLLCLAKNPEKQARLREEVMKVLPNKDSE--FTEASMKNVPYLRACIKESQRVYPLVIGNARGLTRDSVISGYRVPAGTIVSMIPINSLYSEEYFPKPTEFLPERWLRNASDSAGKCPANDLKTKNPFVFLPFGFGPRMCVGKRIVEMEL 492          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP2F3_CAPHI (Cytochrome P450 2F3 OS=Capra hircus GN=CYP2F3 PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 7.546e-12
Identity = 45/175 (25.71%), Postives = 82/175 (46.86%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVS-DIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPY----VYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPL 510
            T    +   F++L ++P+    + +E   ++  +R   + T+ED  ++ YT  V  E  R    I  S    V+ D  + GFTIP+G  V+      H +P  F  P  F+P  F ++   +     ++PF  G RLC G  LA++ + +++  ++  +    +   E I + PL
Sbjct:  302 TVGTTLRHAFRLLMKYPEVQVRVQEEIDRVVGRER---LPTVEDRAEMPYTDAVIHEVQRFADIIPMSLPHRVTRDTNFRGFTIPRGTDVITLLNTVHYDPSQFLKPKEFNPEHFLDANMSFKKSPAFMPFSAGRRLCLGEALARMELFLYLTAILQSFSLQPLGAPEDIDLTPL 473          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C71D6_SOLCH (Cytochrome P450 71D6 OS=Solanum chacoense GN=CYP71D6 PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 7.546e-12
Identity = 42/131 (32.06%), Postives = 66/131 (50.38%), Query Frame = 1
Query:  130 DMKKIKYTWQVARESMRLFPPI-FGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYV-----YLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMD 504
            D++ +KY   V +E+MRL  PI     R+   + E  G+TIP   KV+   +    +P+Y++D   F P RFE+    ++     YLPFGGG R+C G      N  + +  ++  +DW L    E   +D
Sbjct:  347 DVEDLKYLKLVIKETMRLHAPIPLLVPRECRKETEINGYTIPVKTKVMVNVWALGRDPKYWDDVECFKPERFEQCSIDFIGNNFEYLPFGGGRRICPGTSFGLANDYLPLAQLLCHFDWKLPTGMEPKDLD 477          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C71BU_ARATH (Cytochrome P450 71B31 OS=Arabidopsis thaliana GN=CYP71B31 PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 7.546e-12
Identity = 51/157 (32.48%), Postives = 77/157 (49.04%), Query Frame = 1
Query:   25 TFKMLAQHPDCYSLLLQE-HVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSF-RKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESV-----PPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSL 474
            T   L +HP     L +E    +  NK   E +T ED++K++Y   V +ES RL PP      R+ +SDIE +G+ IPK   V    +    +P+ + +P  F+P RF  +        Y  LPFG G R C G  L    + + +  ++  +DWSL
Sbjct:  313 TMTELTRHPRVMKKLQEEIRATLGPNK---ERITEEDLEKVEYLNLVIKESFRLHPPAPLLLPRETMSDIEIQGYHIPKNAHVKINTYAIGRDPKRWTNPEEFNPERFLNTSINYKGQHYELLPFGAGRRNCPGMTLGITILELGLLNILYYFDWSL 466          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C77A1_SOLME (Cytochrome P450 77A1 (Fragment) OS=Solanum melongena GN=CYP77A1 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 9.855e-12
Identity = 45/174 (25.86%), Postives = 81/174 (46.55%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSD-IEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEE--------SVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESI 495
            TT+ A+      L ++P   + L QE   I+ +K+  E     D++K+ Y   V +E +R  PP + +   +V++ ++  G+ IP    V +   G   +P  + DP  FDP RF           V     +PFG G R+C G  +A +++ + +  +V  ++W     N  +
Sbjct:  306 TTATALEWGIGRLMENPTIQNQLYQEIKTIVGDKKVDE----NDIEKMPYLNAVVKELLRKHPPTYFTLTHSVTEPVKLAGYDIPMDTNVEFFVHGISHDPNVWSDPEKFDPDRFLSGREDADITGVKEVKMMPFGVGRRICPGLGMATVHVNLMLARMVQEFEWFAYPGNNKV 475          
The following BLAST results are available for this feature:
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 275
Match NameE-valueIdentityDescription
CP19A_CAPHI5.778e-1226.62Cytochrome P450 19A1 OS=Capra hircus GN=CYP19A1 PE... [more]
CP192_CARAU5.778e-1227.49Cytochrome P450 19 type 2 OS=Carassius auratus GN=... [more]
CP138_MYCTU5.778e-1225.81Putative cytochrome P450 138 OS=Mycobacterium tube... [more]
CP138_MYCBO5.778e-1225.81Putative cytochrome P450 138 OS=Mycobacterium bovi... [more]
C71B3_ARATH5.778e-1228.67Cytochrome P450 71B3 OS=Arabidopsis thaliana GN=CY... [more]
C12A5_DROME5.778e-1227.22Probable cytochrome P450 12a5, mitochondrial OS=Dr... [more]
CP2F3_CAPHI7.546e-1225.71Cytochrome P450 2F3 OS=Capra hircus GN=CYP2F3 PE=2... [more]
C71D6_SOLCH7.546e-1232.06Cytochrome P450 71D6 OS=Solanum chacoense GN=CYP71... [more]
C71BU_ARATH7.546e-1232.48Cytochrome P450 71B31 OS=Arabidopsis thaliana GN=C... [more]
C77A1_SOLME9.855e-1225.86Cytochrome P450 77A1 (Fragment) OS=Solanum melonge... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00180 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00180 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623089 ID=BQ623089|Name=BQ623089|organism=Citrus sinensis|type=EST|length=604bp
ACCACATCTTTTGCCATTGCCATGACGTTTAAGATGTTAGCGCAGCATCC
AGATTGCTATTCTCTCCTCCTACAAGAACATGTTAACATAATGAATAATA
AAAGAGCTGGCGAAATTCTAACACTGGAAGACATGAAGAAGATAAAATAC
ACCTGGCAAGTTGCTCGCGAAAGCATGCGGCTCTTCCCTCCCATCTTCGG
CTCCTTCAGAAAAGCAGTTTCTGACATTGAGTATGAGGGATTCACCATTC
CTAAAGGCTGGAAGGTTTTATGGACAGCATTTGGAACACATTCGAATCCG
GAGTATTTTGAAGATCCTCTGAGTTTCGATCCCAGAAGGTTCGAGGAATC
AGTGCCTCCATATGTCTATCTTCCATTCGGAGGAGGGCCAAGATTGTGCG
CAGGCTACCAACTGGCCAAGCTAAACATCATCATCTTTGTTCATTATGTT
GTAACTCGCTATGATTGGTCTTTAATTAATCCCAACGAGTCAATCACCAT
GGATCCTCTCCCATTTCCTTCCCAAGGAATGCCCATCAAGATTTCTCCCA
AGTTGTAAACAACCAGCAATACGGCTGGGATTTTTCCTTACATAATTATG
TTGG
back to top