BQ623089

Overview
NameBQ623089
Unique NameBQ623089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C516B_DICDI (Probable cytochrome P450 516B1 OS=Dictyostelium discoideum GN=cyp516b1 PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 9.855e-12
Identity = 47/178 (26.40%), Postives = 77/178 (43.26%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPI-FGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF-----------------EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLIN 480
            T +  +      L+ H D    +  E +N++     G +  L   K   Y     +E+MR+         R A  DI+  G+TIPKG +V+ + +G  S+  Y++DP  F+P R+                   S    V++PFG GPR+C G  +AK  +      +   + WS +N
Sbjct:  291 TVAITLGWMILFLSNHQDVQQKVYDELINVVGK---GNLPALVHRKDTSYLNACIQETMRIRTAAPLALPRIASEDIKVGGYTIPKGTQVMMSVYGMASDERYWKDPHIFNPERWLSSNHSTENGGGGGGVVGNSSQSEVFIPFGVGPRMCVGMGVAKDELYYCASQMFMNFKWSPVN 465          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP10_LYMST (Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.287e-11
Identity = 48/192 (25.00%), Postives = 89/192 (46.35%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF--------EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKISPK 552
            TTS A       LA++P     L QE +     K  G I + ED+ K+     V +E++RL+P  + + R    D+E  G+TIP G  V    +G + +P  F +P    P R+        + ++     L +G G R+C G ++A+  + I +  ++  +  S  + +    ++ +  P + + I+  P+
Sbjct:  355 TTSSATVWCLYNLAKNPQVQEKLFQE-ITEAQAKNNGTI-SAEDLCKLPMVKAVVKETLRLYPITYSTSRNIAEDMELGGYTIPAGTHVQANLYGMYRDPSLFPEPEGILPERWLRMNGSQMDATIKSTSQLVWGHGARMCLGRRIAEQEMHITLSKIIQNFTLSYNHDDVEPILNTMLTPDRPVRIEFKPR 544          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C6A20_DROME (Probable cytochrome P450 6a20 OS=Drosophila melanogaster GN=Cyp6a20 PE=2 SV=2)

HSP 1 Score: 69.707 bits (169), Expect = 1.287e-11
Identity = 51/193 (26.42%), Postives = 89/193 (46.11%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEG--FTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESV----PPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSL-----INPNESITMDPLPFPSQGMPIKIS 546
            T+S  +      LA H D    L  E +N +  +  G+ L  + M+++ Y  +V  E+MR  P +    R A    ++    + I KG  V+      H +PE++ +P  F P RF+E      P   +LPFG GPR C G +  ++ +I+ +  ++  + +       + P E  T D L     G+ +K++
Sbjct:  309 TSSTTMGFALYELACHQDIQDKLRTE-INTVLKQHNGK-LDYDSMREMTYLEKVIDETMRKRPVVGHLIRVATQHYQHTNPKYNIEKGTGVIVPTLAIHHDPEFYPEPEKFIPERFDEDQVQQRPACTFLPFGDGPRNCIGLRFGRMQVIVGMALLIHNFKFEFHPTKTVVPLEYRTDDFLLSSKGGIHLKVT 499          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4B1_RAT (Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3)

HSP 1 Score: 69.3218 bits (168), Expect = 1.681e-11
Identity = 52/203 (25.62%), Postives = 91/203 (44.83%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVP----PYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKISPKL*TTSNTAGIFPYI 594
            TT+  I+     +A +P+   L  +E   I+ ++   +    +D+ K+ Y     +E  RL+PP+   +R+    + + +G ++P G  +    +  H N   + DP  FDP RF         P+ ++PF  GPR C G Q A   + +     + R+++SL         DP       MPIK+   +  + N  GI  Y+
Sbjct:  319 TTTSGISWFLYCMALYPEHQQLCREEVRGILGDQ---DSFQWDDLAKMTYLTMCMKECFRLYPPVPQVYRQLNKPVTFVDGRSLPAGSLISLHIYALHRNSTVWPDPEVFDPLRFSPENAAGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFSL---------DP-----SKMPIKVPQLILRSKN--GIHLYL 502          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP2DH_MACFA (Cytochrome P450 2D17 OS=Macaca fascicularis GN=CYP2D17 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.681e-11
Identity = 46/163 (28.22%), Postives = 73/163 (44.79%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPI-FGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEES----VPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSL 474
            TTS  +A    ++  HPD    + QE  +++   R  E   + D  ++ YT  V  E  R    +  G       DIE +GF IPKG  +         +   +E P  F P  F ++    V P  +LPF  G R C G  LA++ + +F   ++ R+ +S+
Sbjct:  309 TTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPE---MGDQARMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIELQGFLIPKGTTLFTNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTCLLQRFSFSV 468          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP2CJ_HUMAN (Cytochrome P450 2C19 OS=Homo sapiens GN=CYP2C19 PE=1 SV=3)

HSP 1 Score: 69.3218 bits (168), Expect = 1.681e-11
Identity = 44/169 (26.04%), Postives = 84/169 (49.70%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVS-DIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPY----VYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDW-SLINPNE 489
            TTS  +     +L +HP+  + + +E   ++   R+     ++D   + YT  V  E  R    I  S   AV+ D+++  + IPKG  +L +      + + F +P  FDPR F +    +     ++PF  G R+C G  LA++ + +F+ +++  ++  SLI+P +
Sbjct:  301 TTSTTLRYALLLLLKHPEVTAKVQEEIERVVGRNRSP---CMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCDVKFRNYLIPKGTTILTSLTSVLHDNKEFPNPEMFDPRHFLDEGGNFKKSNYFMPFSAGKRICVGEGLARMELFLFLTFILQNFNLKSLIDPKD 466          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP17A_ONCMY (Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oncorhynchus mykiss GN=cyp17a1 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.681e-11
Identity = 51/179 (28.49%), Postives = 85/179 (47.49%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFP--PIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF--EES----VPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLP 513
            TTS  +      L  HP     + +E  +++   R  +   L D   + Y     RE +R+ P  P+      A +D     FT+ KG +++   +  H + + +++P  FDP RF  EE     +P   YLPFG G R+C G  LAK+ I +F+ +++ R   + ++P +     PLP
Sbjct:  313 TTSTVLKWAIAYLIHHPQVQQRIQEELDSVVGGDRTPQ---LSDRGSLPYLEATIREVLRIRPVAPLLIP-HVAQTDTSIGKFTVRKGARIIINLWSLHHDEKEWKNPEMFDPGRFLNEEGTGLCIPSPSYLPFGAGVRVCLGEALAKMEIFLFLSWILQRLTMT-VSPGQ-----PLP 481          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C71DC_CATRO (Tabersonine 16-hydroxylase (Fragment) OS=Catharanthus roseus GN=CYP71D12 PE=1 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.681e-11
Identity = 39/118 (33.05%), Postives = 64/118 (54.24%), Query Frame = 1
Query:  133 MKKIKYTWQVARESMRLFPPIFGSF-RKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYV-----YLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDW 468
            + ++KY   V +E++RL PP+     R+     + +G+TIP   +V+  A+    +P Y+ +P  F+P RF ES   +      YLPFGGG R+C G   A  NI + +  ++  +DW
Sbjct:  342 LHQLKYLQAVIKETLRLHPPVPLLLPRECREQCKIKGYTIPSKSRVIVNAWAIGRDPNYWIEPEKFNPDRFLESKVDFKGNSFEYLPFGGGRRICPGITFALANIELPLAQLLFHFDW 459          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C508C_DICDI (Probable cytochrome P450 508C1 OS=Dictyostelium discoideum GN=cyp508c1 PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.681e-11
Identity = 43/129 (33.33%), Postives = 66/129 (51.16%), Query Frame = 1
Query:  118 LTLEDMKKIKYTWQVARESMRLFPPI-FGSFRKAVSDIEY--EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYV--YLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNE 489
            +TL D     Y   + +E+MR+ P + FG  R   +DI    E + IPKG KV         N +YF+DP  F+P RF E+    +  + PFG G R+C G QLA   + + +  ++ +Y    I+ N+
Sbjct:  344 ITLSDRPNTPYIQAIIKETMRMHPVVVFGLPRYCENDIFIGDENYFIPKGCKVFINFHSIGYNEKYFKDPYKFEPNRFLENSNNSMDSFFPFGLGNRVCLGRQLANDQLYLVIANLILKYKLKTIDENK 472          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP52C_CANMA (Cytochrome P450 52A3 OS=Candida maltosa GN=CYP52A3 PE=1 SV=3)

HSP 1 Score: 68.9366 bits (167), Expect = 2.195e-11
Identity = 51/169 (30.18%), Postives = 83/169 (49.11%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQE---HVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY---------EGFTIPKGWKVLWTAFGTHSNPEYF-EDPLSFDPRR-FEESVPP--YVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTR 459
            TT+  ++     LA++P  ++ L +E   +  + +  R  EI + E +KK +Y   V  E++R++P +  +FR A  D                +PKG  V+++ + TH   +++ ED   F P R FE S     + YLPF GGPR+C G Q A    +    YV+ R
Sbjct:  324 TTAGLLSFAMFELARNPKIWNKLREEVEVNFGLGDEARVDEI-SFETLKKCEYLKAVLNETLRMYPSVPINFRTATRDTTLPRGGGKDGNSPIFVPKGSSVVYSVYKTHRLKQFYGEDAYEFRPERWFEPSTRKLGWAYLPFNGGPRICLGQQFA----LTEASYVIAR 487          
The following BLAST results are available for this feature:
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 275
Match NameE-valueIdentityDescription
C516B_DICDI9.855e-1226.40Probable cytochrome P450 516B1 OS=Dictyostelium di... [more]
CP10_LYMST1.287e-1125.00Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 P... [more]
C6A20_DROME1.287e-1126.42Probable cytochrome P450 6a20 OS=Drosophila melano... [more]
CP4B1_RAT1.681e-1125.62Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1... [more]
CP2DH_MACFA1.681e-1128.22Cytochrome P450 2D17 OS=Macaca fascicularis GN=CYP... [more]
CP2CJ_HUMAN1.681e-1126.04Cytochrome P450 2C19 OS=Homo sapiens GN=CYP2C19 PE... [more]
CP17A_ONCMY1.681e-1128.49Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oncorh... [more]
C71DC_CATRO1.681e-1133.05Tabersonine 16-hydroxylase (Fragment) OS=Catharant... [more]
C508C_DICDI1.681e-1133.33Probable cytochrome P450 508C1 OS=Dictyostelium di... [more]
CP52C_CANMA2.195e-1130.18Cytochrome P450 52A3 OS=Candida maltosa GN=CYP52A3... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00180 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00180 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623089 ID=BQ623089|Name=BQ623089|organism=Citrus sinensis|type=EST|length=604bp
ACCACATCTTTTGCCATTGCCATGACGTTTAAGATGTTAGCGCAGCATCC
AGATTGCTATTCTCTCCTCCTACAAGAACATGTTAACATAATGAATAATA
AAAGAGCTGGCGAAATTCTAACACTGGAAGACATGAAGAAGATAAAATAC
ACCTGGCAAGTTGCTCGCGAAAGCATGCGGCTCTTCCCTCCCATCTTCGG
CTCCTTCAGAAAAGCAGTTTCTGACATTGAGTATGAGGGATTCACCATTC
CTAAAGGCTGGAAGGTTTTATGGACAGCATTTGGAACACATTCGAATCCG
GAGTATTTTGAAGATCCTCTGAGTTTCGATCCCAGAAGGTTCGAGGAATC
AGTGCCTCCATATGTCTATCTTCCATTCGGAGGAGGGCCAAGATTGTGCG
CAGGCTACCAACTGGCCAAGCTAAACATCATCATCTTTGTTCATTATGTT
GTAACTCGCTATGATTGGTCTTTAATTAATCCCAACGAGTCAATCACCAT
GGATCCTCTCCCATTTCCTTCCCAAGGAATGCCCATCAAGATTTCTCCCA
AGTTGTAAACAACCAGCAATACGGCTGGGATTTTTCCTTACATAATTATG
TTGG
back to top