BQ623089

Overview
NameBQ623089
Unique NameBQ623089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP2A5_MOUSE (Cytochrome P450 2A5 OS=Mus musculus GN=Cyp2a5 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.195e-11
Identity = 43/174 (24.71%), Postives = 79/174 (45.40%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPI-FGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPY----VYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDP 507
            T S  +   F +L +HPD  + + +E   ++   R  +    ED  K+ YT  V  E  R    I  G  R+   D ++  F +PKG +V         +P++F +P  F+P+ F +    +     ++PF  G R C G  LA++ + +F+  ++  + +      + I + P
Sbjct:  305 TVSTTLRYGFLLLMKHPDIEAKVHEEIDRVIGRNRQPKY---EDRMKMPYTEAVIHEIQRFADMIPMGLARRVTKDTKFRDFLLPKGTEVFPMLGSVLKDPKFFSNPKDFNPKHFLDDKGQFKKNDAFVPFSIGKRYCFGEGLARMELFLFLTNIMQNFHFKSTQAPQDIDVSP 475          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP19A_ORYLA (Cytochrome P450 19A1 OS=Oryzias latipes GN=cyp19a1 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.195e-11
Identity = 45/171 (26.32%), Postives = 80/171 (46.78%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLP 513
            T S ++     +L Q+P     LLQE   I+ + +    L  +D++K++       E +R  P +  + R+A+ D   +G  + KG  ++      H   E+F     F    F+++ P   + PFG GPR C G  +A   +++    +VT      + P+E +T+D LP
Sbjct:  319 TLSISLFFMLLLLKQNPHVELQLLQEIDTIVGDSQ----LQNQDLQKLQVLESFINECLRFHPVVDFTMRRALFDDIIDGHRVQKGTNIILNTGRMHRT-EFFHKANEFSLENFQKNTPRRYFQPFGSGPRACVGRHIA---MVMMKSILVTLLSQYSVCPHEGLTLDCLP 481          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP19A_MOUSE (Cytochrome P450 19A1 OS=Mus musculus GN=Cyp19a1 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.195e-11
Identity = 41/154 (26.62%), Postives = 78/154 (50.65%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            T S  +     ++A++P+  + +L+E   ++ ++     + +ED++ +K       ESMR  P +    R+A+ D   +G+ + KG  ++    G     EYF  P  F    FE++VP   + PFG GPR CAG  +A + + + +  ++ R+
Sbjct:  310 TMSVTLYFMLLLVAEYPEVEAAILKEIHTVVGDRD----IKIEDIQNLKVVENFINESMRYQPVVDLVMRRALEDDVIDGYPVKKGTNIILN-IGRMHRLEYFPKPNEFTLENFEKNVPYRYFQPFGFGPRGCAGKYIAMVMMKVVLVTLLRRF 458          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP19A_BOVIN (Cytochrome P450 19A1 OS=Bos taurus GN=CYP19A1 PE=2 SV=3)

HSP 1 Score: 68.9366 bits (167), Expect = 2.195e-11
Identity = 40/154 (25.97%), Postives = 75/154 (48.70%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            T S ++     ++A+HP     +++E   ++  +     + ++DM+K+K       ESMR  P +    RKA+ D   +G+ + KG  ++    G     E+F  P  F    F ++VP   + PFG GPR CAG  +  + + + +  ++ R+
Sbjct:  310 TMSVSVFFMLFLIAKHPQVEEAIIREIQTVVGERD----IRIDDMQKLKVVENFINESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILN-LGRMHRLEFFPKPNEFTLENFAKNVPYRYFQPFGFGPRACAGKYITMVMMKVVLVTLLRRF 458          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP17A_FELCA (Steroid 17-alpha-hydroxylase/17,20 lyase OS=Felis catus GN=CYP17A1 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.195e-11
Identity = 47/162 (29.01%), Postives = 70/162 (43.21%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSF-RKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESV------PPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYD 465
            TT+  +  T   L  HP  Y  L +E   I  N       T+ D  ++       RE +R+ P        KA+ D     F + KG  V+   +  H N + +  P  F P RF +        P   YLPFG GPR C G  LA+  + +F+ +++ R+D
Sbjct:  306 TTTSVVRWTVAFLLHHPQLYKKLQEE---IDQNIGFSRTPTMSDRNQLILLEATIREVLRIRPVAPTLIPHKAIMDSSIGEFAVDKGTNVIINLWALHHNEKEWYRPDQFMPERFLDPTRSQLISPSLSYLPFGAGPRSCLGESLARQEVFLFMAWLLQRFD 464          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C11B2_MESAU (Cytochrome P450 11B2, mitochondrial OS=Mesocricetus auratus GN=CYP11B2 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.195e-11
Identity = 43/156 (27.56%), Postives = 80/156 (51.28%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAV--SDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            TT+F + M    LA++PD    + QE +    +  A     + D+  ++    V +E++RL+P   G F + +  SD+  + + +P G  VL   +    NP  F  P  + P+R+ E    + +L FG G R C G +LA++ +++ +H+V+  +
Sbjct:  318 TTTFPLVMALFELARNPDVQQAVRQESLAAEASVAANPQRAMSDLPLLR---AVLKETLRLYP--VGGFLERILSSDLVLQNYHVPAGTLVLLYLYSMGRNPAVFPRPEHYLPQRWLERNGSFQHLTFGFGVRQCLGKRLAQVEMLLLLHHVLKSF 468          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP6D2_DROME (Probable cytochrome P450 6d2 OS=Drosophila melanogaster GN=Cyp6d2 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.867e-11
Identity = 45/162 (27.78%), Postives = 79/162 (48.77%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQE--HVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFT--IPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPY---VYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYD 465
            +T+ A A T   L+ +P+      +E   V + +N +  +  T E ++ +K+      E++R +P +    R+   D    G    I KG  +L + FG   +P YF +P  +DP RF+ +   Y    Y+PFG GPR C   ++ K+N  + V  ++  +D
Sbjct:  318 STAAASAFTLYELSMYPELLKEAQEEVDAVLMKHNLKPKDRFTYEAVQDLKFLDICIMETIRKYPGLPFLNRECTEDYPVPGTNHIIAKGTPILISLFGMQRDPVYFPNPNGYDPHRFDSNNMNYDQAAYMPFGEGPRHCIALRMGKVNSKVAVAKILANFD 479          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4P3_DROME (Probable cytochrome P450 4p3 OS=Drosophila melanogaster GN=Cyp4p3 PE=2 SV=3)

HSP 1 Score: 68.5514 bits (166), Expect = 2.867e-11
Identity = 45/151 (29.80%), Postives = 72/151 (47.68%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPD----CYSLL---LQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYE-GFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLA 417
            TTS  +      ++ +P+    CY  +   + + +NI+N      I  L  +K ++Y     +E+MRLFP +    R+   + E   G  +PKG ++    F  H NPEY++ P  F P RF     ++   Y Y+PF  G R C G + A
Sbjct:  326 TTSIGLMFGLMNMSLYPEEQEKCYQEIQANIDDELNILN------IGQLNKLKNLEY---FIKETMRLFPSVPAMGRETTRETELSNGLILPKGSQIFVHVFDIHRNPEYWDSPEEFRPERFLPENSQNRHTYAYIPFSAGQRNCIGQKFA 467          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP2DJ_CALJA (Cytochrome P450 2D19 OS=Callithrix jacchus GN=CYP2D19 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.867e-11
Identity = 46/163 (28.22%), Postives = 72/163 (44.17%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPI-FGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEES----VPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSL 474
            TTS  +A    ++  HPD    + QE  +++   R  E   + D   + YT  V  E  R    +  G       DIE +GF IPKG  +         +   +E P  F P  F ++    V P  +LPF  G R C G  LA++ + +F   ++ R+ +S+
Sbjct:  309 TTSITLAWGLLLMILHPDVQRRVQQEIDDVIGRVRRPE---MGDQTYMPYTTAVIHEVQRFADIVPLGVTHMTSRDIEVQGFLIPKGTTLFTNLSSVLKDEANWEKPFRFHPEHFLDAQGRFVKPEAFLPFSAGRRACLGEPLARMELFLFFTCLLQRFSFSV 468          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP2A1_RAT (Cytochrome P450 2A1 OS=Rattus norvegicus GN=Cyp2a1 PE=1 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 2.867e-11
Identity = 47/177 (26.55%), Postives = 78/177 (44.07%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRL--FPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPY----VYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLP 513
            T S  +   F +L +HPD  + + +E   ++   R  +    ED  K+ YT  V  E  R     P+ G  R+ + +  + GF +PKG  V        ++P++F  P  FDP+ F +          +LPF  G R C G  LAK+ + + +  ++  + +      E I   P P
Sbjct:  303 TVSSTLRYGFLLLMKHPDVEAKVHEEIEQVIGRNRQPQY---EDHMKMPYTQAVINEIQRFSNLAPL-GIPRRIIKNTTFRGFFLPKGTDVFPILGSLMTDPKFFPSPKDFDPQNFLDDKGQLKKNAAFLPFSTGKRFCLGDGLAKMELFLLLTTILQNFRFKFPMKLEDINESPKP 475          
The following BLAST results are available for this feature:
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 275
Match NameE-valueIdentityDescription
CP2A5_MOUSE2.195e-1124.71Cytochrome P450 2A5 OS=Mus musculus GN=Cyp2a5 PE=2... [more]
CP19A_ORYLA2.195e-1126.32Cytochrome P450 19A1 OS=Oryzias latipes GN=cyp19a1... [more]
CP19A_MOUSE2.195e-1126.62Cytochrome P450 19A1 OS=Mus musculus GN=Cyp19a1 PE... [more]
CP19A_BOVIN2.195e-1125.97Cytochrome P450 19A1 OS=Bos taurus GN=CYP19A1 PE=2... [more]
CP17A_FELCA2.195e-1129.01Steroid 17-alpha-hydroxylase/17,20 lyase OS=Felis ... [more]
C11B2_MESAU2.195e-1127.56Cytochrome P450 11B2, mitochondrial OS=Mesocricetu... [more]
CP6D2_DROME2.867e-1127.78Probable cytochrome P450 6d2 OS=Drosophila melanog... [more]
CP4P3_DROME2.867e-1129.80Probable cytochrome P450 4p3 OS=Drosophila melanog... [more]
CP2DJ_CALJA2.867e-1128.22Cytochrome P450 2D19 OS=Callithrix jacchus GN=CYP2... [more]
CP2A1_RAT2.867e-1126.55Cytochrome P450 2A1 OS=Rattus norvegicus GN=Cyp2a1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00180 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00180 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623089 ID=BQ623089|Name=BQ623089|organism=Citrus sinensis|type=EST|length=604bp
ACCACATCTTTTGCCATTGCCATGACGTTTAAGATGTTAGCGCAGCATCC
AGATTGCTATTCTCTCCTCCTACAAGAACATGTTAACATAATGAATAATA
AAAGAGCTGGCGAAATTCTAACACTGGAAGACATGAAGAAGATAAAATAC
ACCTGGCAAGTTGCTCGCGAAAGCATGCGGCTCTTCCCTCCCATCTTCGG
CTCCTTCAGAAAAGCAGTTTCTGACATTGAGTATGAGGGATTCACCATTC
CTAAAGGCTGGAAGGTTTTATGGACAGCATTTGGAACACATTCGAATCCG
GAGTATTTTGAAGATCCTCTGAGTTTCGATCCCAGAAGGTTCGAGGAATC
AGTGCCTCCATATGTCTATCTTCCATTCGGAGGAGGGCCAAGATTGTGCG
CAGGCTACCAACTGGCCAAGCTAAACATCATCATCTTTGTTCATTATGTT
GTAACTCGCTATGATTGGTCTTTAATTAATCCCAACGAGTCAATCACCAT
GGATCCTCTCCCATTTCCTTCCCAAGGAATGCCCATCAAGATTTCTCCCA
AGTTGTAAACAACCAGCAATACGGCTGGGATTTTTCCTTACATAATTATG
TTGG
back to top