BQ623089

Overview
NameBQ623089
Unique NameBQ623089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP193_PIG (Cytochrome P450 19 type III OS=Sus scrofa GN=CYP19A3 PE=2 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 2.867e-11
Identity = 42/154 (27.27%), Postives = 73/154 (47.40%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            T S  +     ++A HP     L++E   ++  +     +  +DM+K+K       ESMR  P +    RKA+ D   +G+ + KG  ++    G     E+F  P  F    F ++VP   + PFG GPR CAG  +A + + + +  ++ R+
Sbjct:  308 TMSITVFFMLFLIANHPQVEEELMKEIYTVVGERD----IRNDDMQKLKVVENFIYESMRYQPVVDFVMRKALEDDVIDGYPVKKGTNIILN-IGRMHRLEFFPKPNEFTLENFAKNVPYRYFQPFGFGPRACAGKYIAMVMMKVILVTLLRRF 456          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C97B2_SOYBN (Cytochrome P450 97B2 OS=Glycine max GN=CYP97B2 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.867e-11
Identity = 50/201 (24.88%), Postives = 85/201 (42.29%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFP-PIFGSFRKAVSDI-------EYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF--------------------------EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITM 501
            TT+  +     +LAQ+P        E   ++   R     T E +K+++Y   +  E++RL+P P     R   SD+       E +G+ IP G  V  + +  H +P +++ P  F+P RF                           E +  + +LPFGGGPR C G Q A +   + +  ++  +D  L    ES+ +
Sbjct:  357 TTAAVLTWAVFLLAQNPSKMKKAQAEVDLVLGTGRP----TFESLKELQYIRLIVVEALRLYPQPPLLIRRSLKSDVLPGGHKGEKDGYAIPAGTDVFISVYNLHRSPYFWDRPDDFEPERFLVQNKNEEIEGWAGLDPSRSPGALYPNEVISDFAFLPFGGGPRKCVGDQFALMESTVALTMLLQNFDVELKGTPESVEL 553          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C71BD_ARATH (Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.867e-11
Identity = 45/164 (27.44%), Postives = 80/164 (48.78%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPI-FGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPY-----VYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSL 474
            T+   I      L ++P        E   ++ NK   + +T ED++ ++Y   V +E++R+ P +   + R+A  D++  G+ IPK   +    +  H NP  ++DP +F P RF ++   Y       LPFG G R+C G  +    I + +  ++ R+DW L
Sbjct:  301 TSGHTITWVMTHLIKNPRVMKKAQAEVREVIKNK---DNITEEDIEGLEYLKMVVKETLRINPLVPLLTPREASKDVKIGGYNIPKKTWIHVNIWAIHRNPNVWKDPEAFIPERFMDNQIDYKGLNFELLPFGSGRRICPGIGMGMALIHLTLINLLYRFDWKL 461          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C71B4_ARATH (Cytochrome P450 71B4 OS=Arabidopsis thaliana GN=CYP71B4 PE=2 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 2.867e-11
Identity = 46/175 (26.29%), Postives = 88/175 (50.29%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFP--PIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPY-----VYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMD 504
            T++  +      L ++P        E    +  K+ G I+  ED+ K++Y   V +E++RL P  P+    R+ ++DI+ +G+ IP+   +L  A+    +PE +++P  F+P RF +    Y       LPFG G R+C G  +A   I + +  ++  +DW++    + + M+
Sbjct:  309 TSAITLIWAMAELVRNPRVMKKAQDEIRTCIGIKQEGRIME-EDLDKLQYLKLVVKETLRLHPAAPLLLP-RETMADIKIQGYDIPQKRALLVNAWSIGRDPESWKNPEEFNPERFIDCPVDYKGHSFELLPFGSGRRICPGIAMAIATIELGLLNLLYFFDWNMPEKKKDMDME 481          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: F3PH_ARATH (Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.745e-11
Identity = 55/212 (25.94%), Postives = 91/212 (42.92%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSD-IEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF---------EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSL--------INPNESITMDPLPFPSQGMPIKISPKL*TTSNTAGI 582
            T++  +      L +HPD   +  QE ++I+  +     +   D+ ++ Y   V +E+ RL PP   S     S+  E  G+ IPKG  +L   +    +P+ + DPL+F P RF         +     +  +PFG G R+CAG  L    I      +V  +DW L        +N  ES  +       + +P+ + PK     N  G+
Sbjct:  306 TSASTVDWAIAELIRHPDIM-VKAQEELDIVVGR--DRPVNESDIAQLPYLQAVIKENFRLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWSDPLAFKPERFLPGGEKSGVDVKGSDFELIPFGAGRRICAGLSLGLRTIQFLTATLVQGFDWELAGGVTPEKLNMEESYGLT----LQRAVPLVVHPKPRLAPNVYGL 510          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP6B6_HELAM (Cytochrome P450 6B6 OS=Helicoverpa armigera GN=CYP6B6 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.745e-11
Identity = 53/190 (27.89%), Postives = 96/190 (50.53%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEG--FTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE-ESV---PPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKISPK 552
            T++  +A     LA  PD  + L+ E   ++  K     +T + +K++KY  +   E++R++  +    RKA  D +  G    I K   VL +  G H +P+Y+++P  F+P RF+ E V    P  YLPFG G R C G +  +L  ++ +  +++++    I P+++   +    P +G+   I PK
Sbjct:  309 TSATTMAYMIYQLALSPDIQNKLIAEVDEVL--KANDGKVTYDTVKEMKYMNKAFDETLRMYSIVEPLQRKATRDYKIPGTDVVIEKDTIVLISPRGIHYDPKYYDNPKQFNPDRFDAEEVGKRHPCAYLPFGLGQRNCIGMRFGRLQSLLCITKILSKF---RIEPSKNTDRNLQVEPHRGL---IGPK 490          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4P2_DROME (Probable cytochrome P450 4p2 OS=Drosophila melanogaster GN=Cyp4p2 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.745e-11
Identity = 44/148 (29.73%), Postives = 70/148 (47.30%), Query Frame = 1
Query:   40 AQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYE-GFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEE----SVPPYVYLPFGGGPRLCAGYQLA-----KLNIIIFVHYVV 453
            A+   CY  + +  ++ ++N      L L  + K+ Y     +E+MRL+P I    R+ + + E E G  +PK  ++    F  H NP+Y+E P  F P RF         PY Y+PF  G R C G + A      L ++I  H+ +
Sbjct:  346 AEQELCYQEIQEHILDDLSN------LNLSQLSKLNYLGYFIKETMRLYPSIPIMGRQTLQETELENGLILPKRSQINIHVFDIHRNPKYWESPEEFRPERFLPQNCLKRHPYAYIPFSAGQRNCIGQKYAMQEMKTLMVVILKHFKI 487          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP304_DROME (Probable cytochrome P450 304a1 OS=Drosophila melanogaster GN=Cyp304a1 PE=1 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 3.745e-11
Identity = 54/180 (30.00%), Postives = 86/180 (47.78%), Query Frame = 1
Query:   13 AIAMTFKMLAQHPDCYSLLLQEHVNIMNNK-RAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSF-RKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEES-----VPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGM 531
            AI +   +L Q+   Y  +L+   N ++     G +  LED K + +T    RE +R+   +      KA+ D E  G+ IPK   V+ + +  HS+   + DP  F P RF ++     +   V LPFG G RLCAG   A+ N++  V   + ++   ++ PN     D LP  SQ +
Sbjct:  319 AIGVQLSLLVQYLMLYPAVLRRVQNEIDEVVGCGRLPNLEDRKNLPFTEATIREGLRIETLVPSDVPHKALEDTELLGYRIPKDTIVVPSLYAFHSDARIWSDPEQFRPERFLDADGKLCLKLDVSLPFGAGKRLCAGETFAR-NMLFLVTATMCQHFDFVLGPN-----DRLPDLSQNL 492          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP19A_LAGAC (Cytochrome P450 19A1 OS=Lagenorhynchus acutus GN=CYP19A1 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.745e-11
Identity = 40/139 (28.78%), Postives = 67/139 (48.20%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLA 417
            T S ++     ++A+HP     +++E   ++  +     + ++DM+K+K       ESMR  P +    RKA+ D   +G+ + KG  ++    G     E+F  P  F    F  +VP   + PFG GPR CAG  +A
Sbjct:  310 TMSVSVFFMLFLIAKHPQVEEAIMKEIQTVVGERD----IRIDDMQKLKVVENFIYESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILN-IGRMHRLEFFPKPNEFTLENFARNVPYRYFQPFGFGPRACAGKYIA 443          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C4AE1_DROME (Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.745e-11
Identity = 51/189 (26.98%), Postives = 86/189 (45.50%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF--EES--VPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKISPKL 555
            TT+ A++    +L++H      L +E + +   +     + L D   + Y   V +ES+RL+PPI    R    D+  +   IP G  V+   +    +   F DPL F P R   EE+  + PY Y+PF  GPR C G + A L +   V  V+  Y    +  +   ++  +     G+ + + P+L
Sbjct:  308 TTTSAVSFCLYLLSRHEAVQQKLFEE-LRMHYGQDLFRGVILSDFATLPYLSCVVKESLRLYPPIPAVARCLEKDLVIDEGYIPVGTNVVVLLWQLLRDEAIFTDPLVFQPERHLGEEAPRLSPYSYIPFSAGPRNCIGQKFALLEMKTMVTKVIRHYQLLPMGADVEPSIKIVLRSKSGVNVGLRPRL 495          
The following BLAST results are available for this feature:
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 275
Match NameE-valueIdentityDescription
CP193_PIG2.867e-1127.27Cytochrome P450 19 type III OS=Sus scrofa GN=CYP19... [more]
C97B2_SOYBN2.867e-1124.88Cytochrome P450 97B2 OS=Glycine max GN=CYP97B2 PE=... [more]
C71BD_ARATH2.867e-1127.44Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=C... [more]
C71B4_ARATH2.867e-1126.29Cytochrome P450 71B4 OS=Arabidopsis thaliana GN=CY... [more]
F3PH_ARATH3.745e-1125.94Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana... [more]
CP6B6_HELAM3.745e-1127.89Cytochrome P450 6B6 OS=Helicoverpa armigera GN=CYP... [more]
CP4P2_DROME3.745e-1129.73Probable cytochrome P450 4p2 OS=Drosophila melanog... [more]
CP304_DROME3.745e-1130.00Probable cytochrome P450 304a1 OS=Drosophila melan... [more]
CP19A_LAGAC3.745e-1128.78Cytochrome P450 19A1 OS=Lagenorhynchus acutus GN=C... [more]
C4AE1_DROME3.745e-1126.98Cytochrome P450 4ae1 OS=Drosophila melanogaster GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00180 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00180 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623089 ID=BQ623089|Name=BQ623089|organism=Citrus sinensis|type=EST|length=604bp
ACCACATCTTTTGCCATTGCCATGACGTTTAAGATGTTAGCGCAGCATCC
AGATTGCTATTCTCTCCTCCTACAAGAACATGTTAACATAATGAATAATA
AAAGAGCTGGCGAAATTCTAACACTGGAAGACATGAAGAAGATAAAATAC
ACCTGGCAAGTTGCTCGCGAAAGCATGCGGCTCTTCCCTCCCATCTTCGG
CTCCTTCAGAAAAGCAGTTTCTGACATTGAGTATGAGGGATTCACCATTC
CTAAAGGCTGGAAGGTTTTATGGACAGCATTTGGAACACATTCGAATCCG
GAGTATTTTGAAGATCCTCTGAGTTTCGATCCCAGAAGGTTCGAGGAATC
AGTGCCTCCATATGTCTATCTTCCATTCGGAGGAGGGCCAAGATTGTGCG
CAGGCTACCAACTGGCCAAGCTAAACATCATCATCTTTGTTCATTATGTT
GTAACTCGCTATGATTGGTCTTTAATTAATCCCAACGAGTCAATCACCAT
GGATCCTCTCCCATTTCCTTCCCAAGGAATGCCCATCAAGATTTCTCCCA
AGTTGTAAACAACCAGCAATACGGCTGGGATTTTTCCTTACATAATTATG
TTGG
back to top