BQ623089

Overview
NameBQ623089
Unique NameBQ623089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C13A5_CAEEL (Putative cytochrome P450 CYP13A5 OS=Caenorhabditis elegans GN=cyp-13A5 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.745e-11
Identity = 45/169 (26.63%), Postives = 84/169 (49.70%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFP-PIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYF-EDPLSFDPRRFEESVPPYV----YLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNE 489
            TT+ +++ +  +LA+HP+    L +E    ++ +     +T + + K+KY   V +E++R++P       RK + +    G  I KG  V    +  H +P+ + ED   F P R+E     +     YLPFG GPR+C G +LA +   + + +++ +Y +      E
Sbjct:  330 TTALSLSYSSYLLARHPEIQKKLQEE----VDRECPNPEVTFDQISKLKYMECVVKEALRMYPLASIVHNRKCMKETNVLGVQIEKGTNVQVDTWTLHYDPKVWGEDANEFRPERWESGDELFYAKGGYLPFGMGPRICIGMRLAMMEKKMLLTHILKKYTFETSTQTE 494          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C12B1_DROAC (Cytochrome P450 12b1, mitochondrial OS=Drosophila acanthoptera GN=Cyp12b1 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.745e-11
Identity = 51/171 (29.82%), Postives = 78/171 (45.61%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF--------------EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWS 471
            TTS A       LA++P     L +E   I+ +  + E LT E+ K + Y     +E MR+     G+FR A  D+   G+ +P+G  VL       ++ +YF     F P R+                S  P+VYL FG GPR C G ++A+L +   +  ++ RY  S
Sbjct:  336 TTSSAFVTILYHLARNPHKQRQLHRERRRILPD--SDEPLTPENTKNMPYLRACIKECMRITSITPGNFRIATKDLVLSGYRVPRGEGVLMGVLELSNSEKYFGQSGQFMPERWLKADTDPDVKACPAARSRNPFVYLAFGFGPRTCIGKRIAELEMETLLTRLLRRYQVS 504          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C11B2_MOUSE (Cytochrome P450 11B2, mitochondrial OS=Mus musculus GN=Cyp11b2 PE=2 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 3.745e-11
Identity = 44/156 (28.21%), Postives = 78/156 (50.00%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSF--RKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            TT+  + MT   LA++PD    L QE +    +  A     + D+  +K      +E++RL+P   G F  R   SD+  + + +P G  VL   +    NP  F  P  + P+R+ E    + +L FG G R C G +LA++ +++ +H+++  +
Sbjct:  318 TTAIPLVMTLFELARNPDVQKALRQESLAAEASIAANPQKAMSDLPLLK---AALKETLRLYP--VGGFLGRILSSDLVLQNYHVPAGTLVLLYLYSMGRNPAVFPRPERYMPQRWLERKRSFQHLAFGFGVRQCLGRRLAEVEMMLLLHHILKTF 468          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP51_MYCTU (Lanosterol 14-alpha demethylase OS=Mycobacterium tuberculosis GN=cyp51 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 4.891e-11
Identity = 45/173 (26.01%), Postives = 81/173 (46.82%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEES-----VPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMD 504
            T+S   + T   L +H D Y+ ++ E   +  + R+   ++   +++I     V +E++RL PP+    R A  + E +G  I +G  V  +   ++  PE F DP  F P R+E+      +  + ++PFG G   C G   A + I      ++  Y++ +  P ES   D
Sbjct:  260 TSSGTASWTLIELMRHRDAYAAVIDELDELYGDGRS---VSFHALRQIPQLENVLKETLRLHPPLIILMRVAKGEFEVQGHRIHEGDLVAASPAISNRIPEDFPDPHDFVPARYEQPRQEDLLNRWTWIPFGAGRHRCVGAAFAIMQIKAIFSVLLREYEFEMAQPPESYRND 429          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP51_MYCBO (Lanosterol 14-alpha demethylase OS=Mycobacterium bovis GN=cyp51 PE=3 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 4.891e-11
Identity = 45/173 (26.01%), Postives = 81/173 (46.82%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEES-----VPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMD 504
            T+S   + T   L +H D Y+ ++ E   +  + R+   ++   +++I     V +E++RL PP+    R A  + E +G  I +G  V  +   ++  PE F DP  F P R+E+      +  + ++PFG G   C G   A + I      ++  Y++ +  P ES   D
Sbjct:  260 TSSGTASWTLIELMRHRDAYAAVIDELDELYGDGRS---VSFHALRQIPQLENVLKETLRLHPPLIILMRVAKGEFEVQGHRIHEGDLVAASPAISNRIPEDFPDPHDFVPARYEQPRQEDLLNRWTWIPFGAGRHRCVGAAFAIMQIKAIFSVLLREYEFEMAQPPESYRND 429          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4B1_HUMAN (Cytochrome P450 4B1 OS=Homo sapiens GN=CYP4B1 PE=1 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 4.891e-11
Identity = 47/189 (24.87%), Postives = 85/189 (44.97%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVP----PYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQ-GMPIKISP 549
            TT+  I+     +A +P+      +E   I+ ++   +    +D+ K+ Y     +ES RL+PP+   +R+    + + +G ++P G  +    +  H N   + DP  FD  RF         P+ ++PF  GPR C G Q A   + +     + R+++SL      I M  L   S+ G  + + P
Sbjct:  319 TTTSGISWFLYCMALYPEHQHRCREEVREILGDQ---DFFQWDDLGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISMHIYALHRNSAVWPDPEVFDSLRFSTENASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSRLPIKMPQLVLRSKNGFHLHLKP 504          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP19A_RABIT (Cytochrome P450 19A1 OS=Oryctolagus cuniculus GN=CYP19A1 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 4.891e-11
Identity = 40/154 (25.97%), Postives = 76/154 (49.35%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            T S ++     ++A+HP     +++E   ++  +     + ++D++K+K       ESMR  P +    RKA+ D   +G+ + KG  ++    G     E+F  P  F    F ++VP   + PFG GPR CAG  +A + + + +  ++ R+
Sbjct:  310 TMSVSVFFMLFLIAKHPSVEEAIMEEIQTVVGERD----IRIDDIQKLKVVENFIYESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILN-IGRMHRLEFFPKPNEFTLENFAKNVPYRYFQPFGFGPRGCAGKYIAMVMMKVILVTLLRRF 458          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP139_MYCTU (Putative cytochrome P450 139 OS=Mycobacterium tuberculosis GN=cyp139 PE=3 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 4.891e-11
Identity = 41/159 (25.79%), Postives = 75/159 (47.17%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESV------PPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTR 459
            TTS A+A     L   P  +     E   ++     G +   +D+  + Y   V  E++RL+ P   S R+ + D+ ++G  I  G  ++++A+ TH  PE + +P  F P R++ +        P+ ++PF GG   C G  +A   + + +  +V R
Sbjct:  238 TTSGALAWAIYALLTVPGTWESAASEVARVLG----GRVPAADDLSALTYLNGVVHETLRLYSPGVISARRVLRDLWFDGHRIRAGRLLIFSAYVTHRLPEIWPEPTEFRPLRWDPNAADYRKPAPHEFIPFSGGLHRCIGAVMATTEMTVILARLVAR 392          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP139_MYCBO (Putative cytochrome P450 139 OS=Mycobacterium bovis GN=cyp139 PE=3 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 4.891e-11
Identity = 41/159 (25.79%), Postives = 75/159 (47.17%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESV------PPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTR 459
            TTS A+A     L   P  +     E   ++     G +   +D+  + Y   V  E++RL+ P   S R+ + D+ ++G  I  G  ++++A+ TH  PE + +P  F P R++ +        P+ ++PF GG   C G  +A   + + +  +V R
Sbjct:  238 TTSGALAWAIYALLTVPGTWESAASEVARVLG----GRVPAADDLSALTYLNGVVHETLRLYSPGVISARRVLRDLWFDGHRIRAGRLLIFSAYVTHRLPEIWPEPTEFRPLRWDPNAADYRKPAPHEFIPFSGGLHRCIGAVMATTEMTVILARLVAR 392          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP131_DROME (Probable cytochrome P450 313a1 OS=Drosophila melanogaster GN=Cyp313a1 PE=3 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 4.891e-11
Identity = 47/149 (31.54%), Postives = 75/149 (50.34%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEI-LTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYE-GFTIPKGWKVLWTAFGTHSNPEYF-EDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLN 426
            T++  +     +LA HP+    + +E   +  +  AG   +T  DM+K+ Y  +V +E++RL P I  + R+  +D+    G  IPKG  +    F TH NPE +  D  +F+P  F     E   PY Y+PF  G R C G + A ++
Sbjct:  301 TSALTVYHALFLLANHPEHQEAVFEELNGVFPD--AGHFGITYPDMQKLDYLERVIKETLRLIPAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNPEVWGPDADNFNPDNFLAENMEQKHPYAYIPFARGKRNCIGSKYAMMS 447          
The following BLAST results are available for this feature:
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 275
Match NameE-valueIdentityDescription
C13A5_CAEEL3.745e-1126.63Putative cytochrome P450 CYP13A5 OS=Caenorhabditis... [more]
C12B1_DROAC3.745e-1129.82Cytochrome P450 12b1, mitochondrial OS=Drosophila ... [more]
C11B2_MOUSE3.745e-1128.21Cytochrome P450 11B2, mitochondrial OS=Mus musculu... [more]
CP51_MYCTU4.891e-1126.01Lanosterol 14-alpha demethylase OS=Mycobacterium t... [more]
CP51_MYCBO4.891e-1126.01Lanosterol 14-alpha demethylase OS=Mycobacterium b... [more]
CP4B1_HUMAN4.891e-1124.87Cytochrome P450 4B1 OS=Homo sapiens GN=CYP4B1 PE=1... [more]
CP19A_RABIT4.891e-1125.97Cytochrome P450 19A1 OS=Oryctolagus cuniculus GN=C... [more]
CP139_MYCTU4.891e-1125.79Putative cytochrome P450 139 OS=Mycobacterium tube... [more]
CP139_MYCBO4.891e-1125.79Putative cytochrome P450 139 OS=Mycobacterium bovi... [more]
CP131_DROME4.891e-1131.54Probable cytochrome P450 313a1 OS=Drosophila melan... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00180 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00180 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623089 ID=BQ623089|Name=BQ623089|organism=Citrus sinensis|type=EST|length=604bp
ACCACATCTTTTGCCATTGCCATGACGTTTAAGATGTTAGCGCAGCATCC
AGATTGCTATTCTCTCCTCCTACAAGAACATGTTAACATAATGAATAATA
AAAGAGCTGGCGAAATTCTAACACTGGAAGACATGAAGAAGATAAAATAC
ACCTGGCAAGTTGCTCGCGAAAGCATGCGGCTCTTCCCTCCCATCTTCGG
CTCCTTCAGAAAAGCAGTTTCTGACATTGAGTATGAGGGATTCACCATTC
CTAAAGGCTGGAAGGTTTTATGGACAGCATTTGGAACACATTCGAATCCG
GAGTATTTTGAAGATCCTCTGAGTTTCGATCCCAGAAGGTTCGAGGAATC
AGTGCCTCCATATGTCTATCTTCCATTCGGAGGAGGGCCAAGATTGTGCG
CAGGCTACCAACTGGCCAAGCTAAACATCATCATCTTTGTTCATTATGTT
GTAACTCGCTATGATTGGTCTTTAATTAATCCCAACGAGTCAATCACCAT
GGATCCTCTCCCATTTCCTTCCCAAGGAATGCCCATCAAGATTTCTCCCA
AGTTGTAAACAACCAGCAATACGGCTGGGATTTTTCCTTACATAATTATG
TTGG
back to top