BQ623089

Overview
NameBQ623089
Unique NameBQ623089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C77A2_SOLME (Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77A2 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.388e-11
Identity = 45/166 (27.11%), Postives = 78/166 (46.99%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSD-IEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE--------ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWS 471
            TT+ AI      L ++P+  S L +E    +   +  E    +D++K+ Y   V +E +R  PP + S   AV++  +  G+ IP G  V     G   +P  + +P  FDP RF           V     +PFG G R+C G  +A +++ + +  +V  ++W+
Sbjct:  319 TTATAIEWAIGRLIENPNIQSQLYEEIKKTVGENKIDE----KDIEKMPYLNAVVKELLRKHPPTYMSLTHAVTEPAKLGGYDIPTGVNVEIFLPGISDDPNLWSEPEKFDPDRFYLGKEDADITGVSGVKMIPFGMGRRICPGLNMATVHVSLMLARLVQEFEWA 480          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C71B5_ARATH (Cytochrome P450 71B5 OS=Arabidopsis thaliana GN=CYP71B5 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.388e-11
Identity = 51/176 (28.98%), Postives = 83/176 (47.16%), Query Frame = 1
Query:    7 SFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSF-RKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPY-----VYLPFGGGPRLC----AGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMD 504
            S  +  T   L++HP     L +E    +   +  E +T ED++K++Y   V  E+ RL PP      R  +SDI  +G++IPK   +    +    +P+ +  P  F P RF ++   Y       LPFG G R+C     G  + +L ++  +++    +DWSL  PN   T D
Sbjct:  305 SITMIWTMTELSRHPRVMRKLQEEIRAALGPNK--EKITEEDLEKVEYLKMVIEEAFRLHPPAPLLLPRLTMSDINIQGYSIPKNTMIQINTYTIGRDPKNWTKPDEFIPERFVDNPIEYKGQHFELLPFGAGRRVCPGMATGITIVELGLLSLLYF----FDWSL--PNGMTTKD 472          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C4AC1_DROME (Probable cytochrome P450 4ac1 OS=Drosophila melanogaster GN=Cyp4ac1 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.388e-11
Identity = 46/172 (26.74%), Postives = 78/172 (45.35%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF--EESV--PPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMD 504
            TTS  +  T  MLA H D      +E  N+  +    + +++    K+ Y   V +ES+R+FP +    R+ V +    G  +PK  ++    +    +P +F  P  F P RF  E +V   P+ Y+PF  G R C G + A L + + +  V+  +        E +T +
Sbjct:  321 TTSTCLIFTLLMLALHEDVQKKCYEEVENLPEDS---DDISMFQFNKLVYLECVIKESLRMFPSVPFIGRQCVEETVVNGMVMPKDTQISIHIYDIMRDPRHFPKPDLFQPDRFLPENTVNRHPFAYVPFSAGQRNCIGQKFAILEMKVLLAAVIRNFKLLPATQLEDLTFE 489          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CPXN_ANASP (Probable cytochrome P450 110 OS=Anabaena sp. (strain PCC 7120) GN=cyp110 PE=3 SV=3)

HSP 1 Score: 67.0106 bits (162), Expect = 8.343e-11
Identity = 47/160 (29.38%), Postives = 75/160 (46.88%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSF-RKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF-EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSL 474
            TT+  IA  F  + ++ +    L QE   +  N    EI  L       Y   V++E++R++P +   F R   S I   G+ +     ++ + +  H   + + +P  F P RF E    P  Y+PFGGG R C GY LA L I + +  V++ Y  +L
Sbjct:  265 TTATTIAWAFYQILKNVNVQEKLQQELDRLGANPNPMEIAQLP------YLTAVSQETLRMYPVLPTLFPRITKSSINIAGYQLEPDTTLMASIYLIHYREDLYPNPQQFRPERFIERQYSPSEYIPFGGGSRRCLGYALALLEIKLVIATVLSNYQLAL 418          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4P1_DROME (Cytochrome P450 4p1 OS=Drosophila melanogaster GN=Cyp4p1 PE=1 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 8.343e-11
Identity = 51/151 (33.77%), Postives = 76/151 (50.33%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPD----CYSLLLQEHVNI-MNNKRAGEILTLEDMKKIKYTWQVARESMRLFP--PIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF-EESVP---PYVYLPFGGGPRLCAGYQLA 417
            TTS  +      ++ +PD    CY  + QEH++  ++N   G++       K+KY     +E+ RLFP  PI G  R+AV + E   G  +PKG ++    F  H N +Y++ P  F P RF  E+V     Y Y+PF  G R C G + A
Sbjct:  324 TTSIGLIFGLMNMSLNPDKQELCYQEI-QEHIDDDLSNLDVGQL------NKLKYLEYFMKETTRLFPSVPIMG--REAVQETELANGLILPKGAQITIHVFDIHRNAKYWDSPEEFRPERFLPENVQDRHTYAYVPFSAGQRNCIGKKYA 465          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP2D6_HUMAN (Cytochrome P450 2D6 OS=Homo sapiens GN=CYP2D6 PE=1 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 8.343e-11
Identity = 45/163 (27.61%), Postives = 72/163 (44.17%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPI-FGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEES----VPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSL 474
            TTS  +A    ++  HPD    + QE  +++   R  E   + D   + YT  V  E  R    +  G       DIE +GF IPKG  ++        +   +E P  F P  F ++    V P  +LPF  G R C G  LA++ + +F   ++  + +S+
Sbjct:  309 TTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPE---MGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSV 468          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP2A8_MESAU (Cytochrome P450 2A8 OS=Mesocricetus auratus GN=CYP2A8 PE=1 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 8.343e-11
Identity = 47/187 (25.13%), Postives = 80/187 (42.78%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPI-FGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPY----VYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKIS 546
            T S      F +L ++P   + + +E   ++   R  +    ED  K+ YT  V  E  R    +  G  R    DI++  F IPKG  V         +P++F +P  F+P+ F +    +     ++PF  G R C G  LAK+ + IF   ++  + +      + I + P  F    +P K +
Sbjct:  305 TVSTTTRYGFLLLMKYPHIAAKMHEEIDQVIGRNRQPKY---EDHLKMPYTEAVIYEIQRFVDVVPLGLPRSTTKDIKFRDFLIPKGTDVFPVLSSVLKDPKFFSNPNDFNPQHFSDDKGQFKKSNAFMPFSVGKRYCFGESLAKMELFIFFTTIMQNFCFKSPQAPQDIDVTPQYFSFAAIPPKFT 488          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP192_PIG (Cytochrome P450 19 type II OS=Sus scrofa GN=CYP19A2 PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 8.343e-11
Identity = 41/154 (26.62%), Postives = 74/154 (48.05%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            T S  +     ++A+HP     +++E   ++  +     +  +DM+K+K       ESMR  P +    RKA+ D   +G+ + KG  ++    G     E+F  P  F    F ++VP   + PFG GPR CAG  +A + + + +  ++ R+
Sbjct:  310 TLSVTVFFMLFLIAKHPQVEEAIVKEIQTVIGERD----IRNDDMQKLKVVENFIYESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILN-IGRMHRLEFFPKPNEFTLENFAKNVPYRYFQPFGFGPRACAGKYIAMVMMKVTLVILLRRF 458          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP17A_SQUAC (Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 8.343e-11
Identity = 44/162 (27.16%), Postives = 80/162 (49.38%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFP--PIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYV------YLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            T+S A A     L  HP+    + +E  + +  +R  +   + D   + +      E +R+ P  P+      A++D     +TIPKG +V+   +  H + + +++P +FDP RF +    YV      YLPFG G R+C G  LA++ + +F  +++ R+
Sbjct:  309 TSSTAFAWMIIYLIHHPEVQKKIQEEIDSNIGFERTPK---MSDKGNMNFLNATIHEILRIQPVSPLLIP-HVALADSSIGDYTIPKGTRVIINLWAIHHDEKEWKNPDAFDPGRFLDEDGKYVCSSSESYLPFGAGTRVCLGEMLARMELFLFTSWILQRF 466          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C6A19_DROME (Probable cytochrome P450 6a19 OS=Drosophila melanogaster GN=Cyp6a19 PE=1 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 8.343e-11
Identity = 47/171 (27.49%), Postives = 80/171 (46.78%), Query Frame = 1
Query:    7 SFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEG--FTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESV----PPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITM 501
            S  +  T   LA + D    L  E  +++  +R    L  + M+ + Y  +V  ES+R  P +    R A    ++    + I  G  VL +  G H +PE++ +P  F P RF+E      P   +LPFG GPR C G +  ++ +II +  ++  + + L +P   + M
Sbjct:  311 STTMGFTLYELACNQDVQDKLRAEIDSVL--ERYNGKLEYDSMQDLFYMEKVINESLRKHPVVAHLARIATKPYQHSNPKYFIEAGTGVLVSTLGIHHDPEFYPEPEKFIPERFDEEQVKKRPTCAFLPFGAGPRNCIGLRFGRMQVIIGLALLIHNFRFEL-HPKTPVPM 478          
The following BLAST results are available for this feature:
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 275
Match NameE-valueIdentityDescription
C77A2_SOLME6.388e-1127.11Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77... [more]
C71B5_ARATH6.388e-1128.98Cytochrome P450 71B5 OS=Arabidopsis thaliana GN=CY... [more]
C4AC1_DROME6.388e-1126.74Probable cytochrome P450 4ac1 OS=Drosophila melano... [more]
CPXN_ANASP8.343e-1129.38Probable cytochrome P450 110 OS=Anabaena sp. (stra... [more]
CP4P1_DROME8.343e-1133.77Cytochrome P450 4p1 OS=Drosophila melanogaster GN=... [more]
CP2D6_HUMAN8.343e-1127.61Cytochrome P450 2D6 OS=Homo sapiens GN=CYP2D6 PE=1... [more]
CP2A8_MESAU8.343e-1125.13Cytochrome P450 2A8 OS=Mesocricetus auratus GN=CYP... [more]
CP192_PIG8.343e-1126.62Cytochrome P450 19 type II OS=Sus scrofa GN=CYP19A... [more]
CP17A_SQUAC8.343e-1127.16Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalu... [more]
C6A19_DROME8.343e-1127.49Probable cytochrome P450 6a19 OS=Drosophila melano... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00180 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00180 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623089 ID=BQ623089|Name=BQ623089|organism=Citrus sinensis|type=EST|length=604bp
ACCACATCTTTTGCCATTGCCATGACGTTTAAGATGTTAGCGCAGCATCC
AGATTGCTATTCTCTCCTCCTACAAGAACATGTTAACATAATGAATAATA
AAAGAGCTGGCGAAATTCTAACACTGGAAGACATGAAGAAGATAAAATAC
ACCTGGCAAGTTGCTCGCGAAAGCATGCGGCTCTTCCCTCCCATCTTCGG
CTCCTTCAGAAAAGCAGTTTCTGACATTGAGTATGAGGGATTCACCATTC
CTAAAGGCTGGAAGGTTTTATGGACAGCATTTGGAACACATTCGAATCCG
GAGTATTTTGAAGATCCTCTGAGTTTCGATCCCAGAAGGTTCGAGGAATC
AGTGCCTCCATATGTCTATCTTCCATTCGGAGGAGGGCCAAGATTGTGCG
CAGGCTACCAACTGGCCAAGCTAAACATCATCATCTTTGTTCATTATGTT
GTAACTCGCTATGATTGGTCTTTAATTAATCCCAACGAGTCAATCACCAT
GGATCCTCTCCCATTTCCTTCCCAAGGAATGCCCATCAAGATTTCTCCCA
AGTTGTAAACAACCAGCAATACGGCTGGGATTTTTCCTTACATAATTATG
TTGG
back to top