BQ623089

Overview
NameBQ623089
Unique NameBQ623089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP6L1_BLAGE (Cytochrome P450 6l1 OS=Blattella germanica GN=CYP6L1 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.796e-13
Identity = 48/153 (31.37%), Postives = 75/153 (49.02%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEG--FTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEES----VPPYVYLPFGGGPRLCAGYQLAKLNIIIFV 441
            TTS A+A     LA HP+    L  E +  +     G++ T E +KK+ Y   V  E +R +PP+    R  + D    G    I KG  +  +  G H +  ++ DP  F+P RF +     V P+ Y+PFG GPR C G +L  +++ + +
Sbjct:  302 TTSSAMAFAMYELALHPEIQDRLRTE-IQEVTACHGGQV-TYEGVKKMSYLDMVVSEVLRKYPPMSFIDRVCLHDYHIPGTDVVIEKGTPIFVSLLGLHRDSIFYPDPEDFNPERFNKEKKSGVHPFSYIPFGDGPRNCIGLRLGLMSVKLVI 452          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CCD1P_DROME (Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3)

HSP 1 Score: 75.8702 bits (185), Expect = 1.796e-13
Identity = 45/150 (30.00%), Postives = 77/150 (51.33%), Query Frame = 1
Query:    4 TSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF--------EESVPPYVYLPFGGGPRLCAGYQLAKLNI 429
            T+  ++     L++HPD  + L +E ++IM  K +  +L  E+MK + Y   V +E++R +P   G+ R   +D+   G+ +PKG  VL  +        Y+  P  F P R+        +  V P+ +LPFG GPR+C G ++  L +
Sbjct:  330 TATLLSAVLLCLSKHPDKQAKLREELLSIMPTKDS--LLNEENMKDMPYLRAVIKETLRYYPNGLGTMRTCQNDVILSGYRVPKGTTVLLGSNVLMKEATYYPRPDEFLPERWLRDPETGKKMQVSPFTFLPFGFGPRMCIGKRVVDLEM 477          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C82A1_PEA (Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 1.796e-13
Identity = 51/176 (28.98%), Postives = 85/176 (48.30%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPI-FGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF-------EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY--DWSLINPN-ESI 495
            TT+  +     +L +HP     L +E    +  +R    +   D+ K+ Y   + +E++RL+PP  F S R+   D    G+ I KG +++   +  H +P  + DPL F P RF       +     +  LPFG G R+CAG  L     +  VHY++  +   + ++NP+ ESI
Sbjct:  344 TTAGTLTWAMCLLLKHPHVLEKLKEELNTYIGKERC---VNESDINKLVYLHAIIKETLRLYPPAPFSSPREFTEDCTIGGYHIKKGTRLMPNLWKIHRDPSVWPDPLEFKPERFLSTHKDVDVRGQNFELLPFGSGRRMCAGMSLG----LHMVHYILANFLHSFEILNPSPESI 512          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP6B3_PAPPO (Cytochrome P450 6B3 OS=Papilio polyxenes GN=CYP6B3 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 2.346e-13
Identity = 47/160 (29.38%), Postives = 84/160 (52.50%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEG--FTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE----ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            T++  +   F  LA++PD    L+ E   +++       +T E + ++ +  +V  E++R +P    + R A +D  + G   TI KG  ++ + +G  ++P+Y+ +P  FDP RF     ++  P  YLPF  GPR C G + AK  I + V  V+++Y
Sbjct:  307 TSATTMTYLFYELAKNPDIQDKLIAEIDEVLSRHDGN--ITYECLGEMTFLGRVFDETLRKYPVGDFTQRNAKTDYVFPGTDITIKKGQTIIVSTWGIQNDPKYYPNPEKFDPERFNPENIKNRHPCAYLPFSAGPRNCLGLRFAKWQIEVCVVKVLSKY 464          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP24A_RAT (1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 2.346e-13
Identity = 52/189 (27.51%), Postives = 94/189 (49.74%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF---EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPF--PSQGMPIKISPK 552
            TT+ ++      L+++P     LLQE  +++ + +       ED++ + Y     +ESMRL P +  + R          + +PKG  +        S+ + FED   F P R+   E+ + P+ +LPFG G R+C G +LA+L + + + +++ +YD  +   NE + M  L    PS+ +PI   P+
Sbjct:  330 TTANSLMWILYNLSRNPQAQRRLLQEVQSVLPDNQTPRA---EDLRNMPYLKACLKESMRLTPSVPFTTRTLDKPTVLGEYALPKGTVLTLNTQVLGSSEDNFEDSHKFRPERWLQKEKKINPFAHLPFGIGKRMCIGRRLAELQLHLALCWIIQKYD-IVATDNEPVEMLHLGILVPSRELPIAFRPR 514          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C71DD_MENPI (Cytochrome P450 71D13 OS=Mentha piperita GN=CYP71D13 PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 2.346e-13
Identity = 38/130 (29.23%), Postives = 71/130 (54.62%), Query Frame = 1
Query:  124 LEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYV-----YLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSL---INPNE 489
            ++D++++KY   V +E+MR+ PPI    R    + E  G+TIP   +++   +    NP Y+E P +F P RF++    ++     ++PFG G R+C G      N+ + +  ++  +DW L   +NP++
Sbjct:  343 VDDVQELKYMKSVVKETMRMHPPIPLIPRSCREECEVNGYTIPNKARIMINVWSMGRNPLYWEKPETFWPERFDQVSRDFMGNDFEFIPFGAGRRICPGLNFGLANVEVPLAQLLYHFDWKLAEGMNPSD 472          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C71D7_SOLCH (Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 2.346e-13
Identity = 42/131 (32.06%), Postives = 69/131 (52.67%), Query Frame = 1
Query:  130 DMKKIKYTWQVARESMRLFPPI-FGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYV-----YLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMD 504
            D++++KY   V +E+MRL  P+     R+   + E  G+TIP   KV+   +    +P+Y++D  SF P RFE+    ++     YLPFGGG R+C G      N+ + +  ++  +DW L    E   +D
Sbjct:  346 DVEELKYLKLVIKETMRLHAPVPLLVPRECREETEINGYTIPVKTKVMVNVWALGRDPKYWDDAESFKPERFEQCSIDFIGNNFEYLPFGGGRRICPGISFGLANVYLPLAQLLYHFDWKLPTGMEPKDLD 476          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP132_MYCTU (Putative cytochrome P450 132 OS=Mycobacterium tuberculosis GN=cyp132 PE=3 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 3.064e-13
Identity = 46/161 (28.57%), Postives = 80/161 (49.69%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF---EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSL 474
            TT+ A++  + ++A +P     +L E  +++  +R     T +D+ K+ +T    +ES R F  ++   R+AV D   +G  I +G  V+      H +P ++ DP  FDP RF       P   YLPFGGG R+C G   A + +++    +   + + L
Sbjct:  278 TTANAMSWFWYLMALNPQARDHMLTELDDVLGMRRP----TADDLGKLAWTTACLQESQRYFSSVWIIAREAVDDDIIDGHRIRRGTTVVIPIHHIHHDPRWWPDPDRFDPGRFLRCPTDRPRCAYLPFGGGRRICIGQSFALMEMVLMAAIMSQHFTFDL 434          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP132_MYCBO (Putative cytochrome P450 132 OS=Mycobacterium bovis GN=cyp132 PE=3 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 3.064e-13
Identity = 46/161 (28.57%), Postives = 80/161 (49.69%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF---EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSL 474
            TT+ A++  + ++A +P     +L E  +++  +R     T +D+ K+ +T    +ES R F  ++   R+AV D   +G  I +G  V+      H +P ++ DP  FDP RF       P   YLPFGGG R+C G   A + +++    +   + + L
Sbjct:  278 TTANAMSWFWYLMALNPQARDHMLTELDDVLGMRRP----TADDLGKLAWTTACLQESQRYFSSVWIIAREAVDDDIIDGHRIRRGTTVVIPIHHIHHDPRWWPDPDRFDPGRFLRCPTDRPRCAYLPFGGGRRICIGQSFALMEMVLMAAIMSQHFTFDL 434          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C76B1_HELTU (7-ethoxycoumarin O-deethylase OS=Helianthus tuberosus GN=CYP76B1 PE=1 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 3.064e-13
Identity = 49/164 (29.88%), Postives = 78/164 (47.56%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSF-RKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEES-----VPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSL 474
            TTS  I      L + P   S   +E   ++     G I+  +D+ ++ Y   + +E +RL PP      RK V+ +E  G+TIP G  V   A+    +P  ++D L F P+RF ES        +  +PFG G R+C G  LA   + I +  ++  +DW +
Sbjct:  297 TTSITIEWAMTELLRKPHIMSKAKEELEKVIGK---GSIVKEDDVLRLPYLSCIVKEVLRLHPPSPLLLPRKVVTQVELSGYTIPAGTLVFVNAWAIGRDPTVWDDSLEFKPQRFLESRLDVRGHDFDLIPFGAGRRICPGIPLATRMVPIMLGSLLNNFDWKI 457          
The following BLAST results are available for this feature:
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 275
Match NameE-valueIdentityDescription
CP6L1_BLAGE1.796e-1331.37Cytochrome P450 6l1 OS=Blattella germanica GN=CYP6... [more]
CCD1P_DROME1.796e-1330.00Probable cytochrome P450 12d1 proximal, mitochondr... [more]
C82A1_PEA1.796e-1328.98Cytochrome P450 82A1 (Fragment) OS=Pisum sativum G... [more]
CP6B3_PAPPO2.346e-1329.38Cytochrome P450 6B3 OS=Papilio polyxenes GN=CYP6B3... [more]
CP24A_RAT2.346e-1327.511,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho... [more]
C71DD_MENPI2.346e-1329.23Cytochrome P450 71D13 OS=Mentha piperita GN=CYP71D... [more]
C71D7_SOLCH2.346e-1332.06Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71... [more]
CP132_MYCTU3.064e-1328.57Putative cytochrome P450 132 OS=Mycobacterium tube... [more]
CP132_MYCBO3.064e-1328.57Putative cytochrome P450 132 OS=Mycobacterium bovi... [more]
C76B1_HELTU3.064e-1329.887-ethoxycoumarin O-deethylase OS=Helianthus tubero... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00180 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00180 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623089 ID=BQ623089|Name=BQ623089|organism=Citrus sinensis|type=EST|length=604bp
ACCACATCTTTTGCCATTGCCATGACGTTTAAGATGTTAGCGCAGCATCC
AGATTGCTATTCTCTCCTCCTACAAGAACATGTTAACATAATGAATAATA
AAAGAGCTGGCGAAATTCTAACACTGGAAGACATGAAGAAGATAAAATAC
ACCTGGCAAGTTGCTCGCGAAAGCATGCGGCTCTTCCCTCCCATCTTCGG
CTCCTTCAGAAAAGCAGTTTCTGACATTGAGTATGAGGGATTCACCATTC
CTAAAGGCTGGAAGGTTTTATGGACAGCATTTGGAACACATTCGAATCCG
GAGTATTTTGAAGATCCTCTGAGTTTCGATCCCAGAAGGTTCGAGGAATC
AGTGCCTCCATATGTCTATCTTCCATTCGGAGGAGGGCCAAGATTGTGCG
CAGGCTACCAACTGGCCAAGCTAAACATCATCATCTTTGTTCATTATGTT
GTAACTCGCTATGATTGGTCTTTAATTAATCCCAACGAGTCAATCACCAT
GGATCCTCTCCCATTTCCTTCCCAAGGAATGCCCATCAAGATTTCTCCCA
AGTTGTAAACAACCAGCAATACGGCTGGGATTTTTCCTTACATAATTATG
TTGG
back to top