BQ623089

Overview
NameBQ623089
Unique NameBQ623089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C19AA_DANRE (Cytochrome P450 19A1a OS=Danio rerio GN=cyp19a1a PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 3.064e-13
Identity = 46/171 (26.90%), Postives = 85/171 (49.71%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLP 513
            T S ++     +L Q+PD    +LQE    M++  AG+ L    + K++       ES+R  P +  + R+A+ D   EG+ + KG  ++      H + E+F  P  F    F ++VP   + PFG GPR C G  +A + +   +  +++R+    + P ++ T++ +P
Sbjct:  329 TLSISLFFMLLLLKQNPDVELKILQE----MDSVLAGQSLQHSHLSKLQILESFINESLRFHPVVDFTMRRALDDDVIEGYNVKKGTNIILNVGRMHRS-EFFSKPNQFSLDNFHKNVPSRFFQPFGSGPRSCVGKHIAMVMMKSILVALLSRFS---VCPMKACTVENIP 491          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP6B5_PAPGL (Cytochrome P450 6B5 (Fragment) OS=Papilio glaucus GN=CYP6B5 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 4.001e-13
Identity = 50/158 (31.65%), Postives = 84/158 (53.16%), Query Frame = 1
Query:   13 AIAMTFKM--LAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEG--FTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE-ESV---PPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            A  M+F +  LA++PD    ++ E V+    +  GEI T + + ++ Y  QV  E++R +P      R A +D    G   T+ KG  V+ + FG H +P+Y+ DP  FDP RF  E+V    P  Y+PFG G R C G +  +  + + +  +++++
Sbjct:  309 ASTMSFLLFELAENPDIQEKVIAE-VDETLKRHNGEI-TYDTLSEMTYLTQVFHETLRKYPVADILLRNAKADYAVPGTNVTLKKGQTVVVSGFGIHYDPKYYPDPEKFDPERFSPENVRNRHPCAYIPFGAGQRKCLGMRFGQWQVQVCIIKLLSKF 464          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4Z1_HUMAN (Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 4.001e-13
Identity = 46/159 (28.93%), Postives = 76/159 (47.80%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            TTS AI+     LA++P+       E   ++ +   G  +T E + ++ YT    +E +RL+ P+    R     I + +G ++P G  V    +  H NP ++EDP  F+P RF     E + PY ++PF  G R C G   A +   + V   + R+
Sbjct:  318 TTSSAISWILYCLAKYPEHQQRCRDEIRELLGD---GSSITWEHLSQMPYTTMCIKECLRLYAPVVNISRLLDKPITFPDGRSLPAGITVFINIWALHHNPYFWEDPQVFNPLRFSRENSEKIHPYAFIPFSAGLRNCIGQHFAIIECKVAVALTLLRF 473          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP302_DROME (Cytochrome P450 302a1, mitochondrial OS=Drosophila melanogaster GN=dib PE=2 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 4.001e-13
Identity = 53/189 (28.04%), Postives = 94/189 (49.74%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKK-IKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF---EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKISPKL 555
            TTS+A A     +A++P+    L +E   ++ +  A + L+++ ++  I YT  V +ES+RL P   G  R    D  + G+ +PKG  V+          ++F+DPL F P R+     ++ PY+ LPFG G R C   +LA+ N+ I +  ++  Y+      ++ + +  L       P+ I  +L
Sbjct:  300 TTSYASAFLLYHIARNPEVQQKLHEEARRVLPS--AKDELSMDALRTDITYTRAVLKESLRLNPIAVGVGRILNQDAIFSGYFVPKGTTVVTQNMVACRLEQHFQDPLRFQPDRWLQHRSALNPYLVLPFGHGMRACIARRLAEQNMHILLLRLLREYELIWSGSDDEMGVKTLLINKPDAPVLIDLRL 486          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C71B8_ARATH (Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 4.001e-13
Identity = 52/161 (32.30%), Postives = 81/161 (50.31%), Query Frame = 1
Query:   25 TFKMLAQHPDCYSLLLQE-HVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSF---RKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESV-----PPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLIN 480
            T   L +HP     L +E    +  NK   E +T ED++K++Y   V +E+ RL PP  G F   R+ +SDIE +G+ IPK   +  + +    +P+ + +P  F+P RF  +        Y  LPFG G R C G  L    + + +  ++  +DWSL N
Sbjct:  315 TMTELTRHPRVMKKLREEIRATLGPNK---ERITEEDLEKVEYLKLVIKETFRLHPP--GPFLLPRQVMSDIEIQGYHIPKNAHIKISTYAIGRDPKCWTNPEEFNPERFANTSINYKGQHYELLPFGAGRRSCPGMTLGITILELGLLNILYYFDWSLPN 470          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP6J1_BLAGE (Cytochrome P450 6j1 OS=Blattella germanica GN=CYP6J1 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 5.226e-13
Identity = 45/178 (25.28%), Postives = 83/178 (46.63%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEE----SVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNE-SITMDPLPF 516
            T+S  +      L+ H D  +    E  +++ + +  + +T   +K +KY   V  E++R +P I    R+   D    +   +P G  V    +  H + +YF  P  FDP RF E    ++P + Y+PFG GPR C G +   + +   + ++++ ++ S        + +DP PF
Sbjct:  309 TSSMTLTFALYELSVHQDIQTTARTEIKDVLEHHK--KKVTYYSIKDMKYLDMVVNETLRKYPAIPFLDRRCQEDYPLTQDLMLPAGTGVYIPVYALHHDSKYFPSPAKFDPERFSEKNKQNIPHFAYMPFGEGPRNCIGMRFGSMQVKAALIHILSNFEVSPCKETRIPLIIDPKPF 484          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C6A17_DROME (Probable cytochrome P450 6a17 OS=Drosophila melanogaster GN=Cyp6a17 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 5.226e-13
Identity = 50/173 (28.90%), Postives = 83/173 (47.98%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEG--FTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESV----PPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITM 501
            T+S  +      LA++ D    L +E  N+    +  +  T E +K++KY  QV  E++R +P +    R   +D   E   + I KG  V+  A G H +P+ + +P  F P RF +      P   +LPFG GPR C G +   +   + + Y++  Y +S ++P   I M
Sbjct:  308 TSSTTMGFALYELARNQDVQDKLREEIGNVFG--KHNKEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTDTDFSPEDPKYFIAKGTIVVIPALGIHYDPDIYPEPEIFKPERFTDEEIAARPSCTWLPFGEGPRNCIGLRFGMMQTCVGLAYLIRGYKFS-VSPETQIPM 477          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP52M_DEBHA (Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=CYP52A13 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 6.825e-13
Identity = 54/167 (32.34%), Postives = 81/167 (48.50%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIM---NNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY---------EGFTIPKGWKVLWTAFGTHSNPEYF-EDPLSFDPRRFEESVP-PYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTR 459
            TT+  ++ TF  LA+HP  ++ L +E        ++ R  EI T E +KK +Y   V  E +RL+P +  +FR A                   + KG  V ++ + TH   EY+ +D   F P R+ ES    + Y+PF GGPR+C G Q A    +    Y+VTR
Sbjct:  321 TTAGLLSFTFFELARHPRVFNKLKEEIYEAFGKGDDARVSEI-TFESLKKCEYLKWVMNEMLRLYPSVPVNFRVATKRTTLPRGGGPDGNSPIYVGKGTTVAYSVYSTHRMEEYYGKDADEFKPERWAESRKLGWAYVPFNGGPRICLGQQFA----LTEASYIVTR 482          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4AP_PIG (Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 6.825e-13
Identity = 43/158 (27.22%), Postives = 80/158 (50.63%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE--ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYD 465
            TT+  I+     LA HP+      +E   ++ +   G  +T + + ++ YT    +E++RL+PP+ G  R+    I + +G ++P G  +  + +  H NP+ + +P  FDP RF    +   + ++PF GG R C G Q A   + + V   + R++
Sbjct:  319 TTASGISWILYALASHPEHQQRCREEIQGLLGD---GTSITWDHLDQMPYTTMCIKEALRLYPPVPGVSRELSKPITFPDGRSLPAGIILSLSVYSLHHNPQVWPNPEEFDPSRFAPGSARHSHAFMPFSGGSRNCIGKQFAMNEMKVAVALTLLRFE 473          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4AL_PIG (Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 8.913e-13
Identity = 48/183 (26.23%), Postives = 92/183 (50.27%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE--ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIK 540
            +T+  I+     LA +P+      +E   ++ +   G  +T + + ++ YT    +E++RL+PP+    R+    I + +G ++P G  +  + +G H NP+ + +P  FDP RF    +   + ++PF GG R C G Q A   + + V   + R++   + P+ S     +P P QG+ +K
Sbjct:  319 STASGISWVLYALASNPEHQQRCREEIQGLLGD---GTSITWDHLDQMPYTTMCIKEALRLYPPVPSVGRELSKPITFPDGRSLPAGIILSLSIYGLHHNPQVWPNPEEFDPSRFAPGSARHSHAFMPFSGGSRNCIGKQFAMNEMKVVVALTLLRFE---LAPDPS----RIPVPIQGIVLK 491          
The following BLAST results are available for this feature:
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 275
Match NameE-valueIdentityDescription
C19AA_DANRE3.064e-1326.90Cytochrome P450 19A1a OS=Danio rerio GN=cyp19a1a P... [more]
CP6B5_PAPGL4.001e-1331.65Cytochrome P450 6B5 (Fragment) OS=Papilio glaucus ... [more]
CP4Z1_HUMAN4.001e-1328.93Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2... [more]
CP302_DROME4.001e-1328.04Cytochrome P450 302a1, mitochondrial OS=Drosophila... [more]
C71B8_ARATH4.001e-1332.30Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CY... [more]
CP6J1_BLAGE5.226e-1325.28Cytochrome P450 6j1 OS=Blattella germanica GN=CYP6... [more]
C6A17_DROME5.226e-1328.90Probable cytochrome P450 6a17 OS=Drosophila melano... [more]
CP52M_DEBHA6.825e-1332.34Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=... [more]
CP4AP_PIG6.825e-1327.22Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2... [more]
CP4AL_PIG8.913e-1326.23Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00180 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00180 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623089 ID=BQ623089|Name=BQ623089|organism=Citrus sinensis|type=EST|length=604bp
ACCACATCTTTTGCCATTGCCATGACGTTTAAGATGTTAGCGCAGCATCC
AGATTGCTATTCTCTCCTCCTACAAGAACATGTTAACATAATGAATAATA
AAAGAGCTGGCGAAATTCTAACACTGGAAGACATGAAGAAGATAAAATAC
ACCTGGCAAGTTGCTCGCGAAAGCATGCGGCTCTTCCCTCCCATCTTCGG
CTCCTTCAGAAAAGCAGTTTCTGACATTGAGTATGAGGGATTCACCATTC
CTAAAGGCTGGAAGGTTTTATGGACAGCATTTGGAACACATTCGAATCCG
GAGTATTTTGAAGATCCTCTGAGTTTCGATCCCAGAAGGTTCGAGGAATC
AGTGCCTCCATATGTCTATCTTCCATTCGGAGGAGGGCCAAGATTGTGCG
CAGGCTACCAACTGGCCAAGCTAAACATCATCATCTTTGTTCATTATGTT
GTAACTCGCTATGATTGGTCTTTAATTAATCCCAACGAGTCAATCACCAT
GGATCCTCTCCCATTTCCTTCCCAAGGAATGCCCATCAAGATTTCTCCCA
AGTTGTAAACAACCAGCAATACGGCTGGGATTTTTCCTTACATAATTATG
TTGG
back to top