BQ623089

Overview
NameBQ623089
Unique NameBQ623089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C72B1_PINTA (Abietadienol/abietadienal oxidase OS=Pinus taeda GN=CYP720B1 PE=1 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 2.764e-22
Identity = 61/186 (32.80%), Postives = 102/186 (54.84%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRL--FPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE---ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKI 543
            T+S A+    K L   P   + + +EH  I+  K   + L  +D K +K+T  V  E++RL  F P  G FR+   D + +   IPKGW V      TH + ++  + L+F+P R+E   +    +++ PFGGG RLC G  LA+L + +F+H  +TR+ W  +  +E  +  PLP+ ++G P+++
Sbjct:  295 TSSRAMTFAIKFLTTCPKALTQMKEEHDAILKAKGGHKKLEWDDYKSMKFTQCVINETLRLGNFGP--GVFRETKEDTKVKDCLIPKGWVVFAFLTATHLDEKFHNEALTFNPWRWELDQDVSNNHLFSPFGGGARLCPGSHLARLELALFLHIFITRFRWEAL-ADEHPSYFPLPYLAKGFPMRL 477          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C90D2_ORYSJ (Cytochrome P450 90D2 OS=Oryza sativa subsp. japonica GN=CYP90D2 PE=1 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 3.610e-22
Identity = 62/181 (34.25%), Postives = 95/181 (52.49%), Query Frame = 1
Query:   16 IAMTFKMLAQHPDCYSLLLQEHVNIMNNKR-AGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF-EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKISPK 552
            I +  K L++ P     L +E++ +   K   GE L   D   + +T  V  E++RL   I G  RKAV D+E +G  IPKGW V       H +   +++P  F+P R+ E+ +    + PFGGG RLC G  LA+L   IF+H++VT + W  +   + I   P     +GMPI+++ K
Sbjct:  308 ITLAVKFLSECPLALHQLEEENIQLKRRKTDMGETLQWTDYMSLSFTQHVITETLRLGNIIGGIMRKAVRDVEVKGHLIPKGWCVFVYFRSVHLDDTLYDEPYKFNPWRWKEKDMSNGSFTPFGGGQRLCPGLDLARLEASIFLHHLVTSFRW--VAEEDHIVNFPTVRLKRGMPIRVTAK 486          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C85A3_SOLLC (Cytochrome P450 85A3 OS=Solanum lycopersicum GN=CYP85A3 PE=2 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.050e-21
Identity = 61/184 (33.15%), Postives = 91/184 (49.46%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPY--VYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKIS 546
            T S    M  K L  HP     + +EH  I   K   + +   D K +++T  V  E++RL   + G  RK   D+E  G+ IPKGW++       + +P  + DP +F+P R+ E+   +   +L FGGG RLC G +L    I  F+HY VTRY W  +  N+ +   P      G+ IK+S
Sbjct:  283 TVSTTSMMAVKYLHDHPKALEEIRKEHFAIREKKSLEDPIDYNDFKAMRFTRAVIYETLRLATIVNGVLRKTTQDMELNGYMIPKGWRIYVYTRELNYDPLIYPDPYTFNPWRWLENNLDHQSSFLMFGGGTRLCPGKELGVAEISTFLHYFVTRYRWEEVGGNKLMKF-PRVEALNGLWIKVS 465          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C85A1_ORYSJ (Cytochrome P450 85A1 OS=Oryza sativa subsp. japonica GN=CYP85A1 PE=1 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 1.792e-21
Identity = 57/183 (31.15%), Postives = 94/183 (51.37%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF-EESVPPYV-YLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKI 543
            T S    M  K L+ HP     L +EH +I   K   + +   D K + +T  V  E++RL   + G  RK   D+E  G+ IPKGW++       + +P  + DP++F+P R+ E+++  +  ++ FGGG R+C G ++  + I  F+HY VT+Y W     N +I   P      G+ I++
Sbjct:  285 TMSTTSMMAVKYLSDHPKALEQLRKEHFDIRKGKAPEDAIDWNDFKSMTFTRAVIFETLRLATVVNGLLRKTTQDVEMNGYVIPKGWRIYVYTREINYDPFLYPDPMTFNPWRWLEKNMESHPHFMLFGGGSRMCPGKEVGTVEIATFLHYFVTQYRWE-EEGNNTILKFPRVEAPNGLHIRV 466          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP26A_HUMAN (Cytochrome P450 26A1 OS=Homo sapiens GN=CYP26A1 PE=1 SV=2)

HSP 1 Score: 102.064 bits (253), Expect = 2.340e-21
Identity = 50/147 (34.01%), Postives = 80/147 (54.42%), Query Frame = 1
Query:  118 LTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKIS 546
            L +E ++++KY   V +E++RL PP+ G FR A+   E  G+ IPKGW V+++   TH   E F +   F+P RF     E    + ++PFGGG R C G + AK+ + IF   +    DW L+N   ++   P  +P   +P + +
Sbjct:  345 LDMEILEQLKYIGCVIKETLRLNPPVPGGFRVALKTFELNGYQIPKGWNVIYSICDTHDVAEIFTNKEEFNPDRFMLPHPEDASRFSFIPFGGGLRSCVGKEFAKILLKIFTVELARHCDWQLLNGPPTMKTSPTVYPVDNLPARFT 491          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP26A_DANRE (Cytochrome P450 26A1 OS=Danio rerio GN=cyp26a1 PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 2.340e-21
Identity = 55/163 (33.74%), Postives = 88/163 (53.99%), Query Frame = 1
Query:   70 LQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE----ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKIS 546
            +QE V  M     G+ L++E + ++KYT  V +E++R+ PP+ G FR A+   E  G+ IPKGW V+++   TH   + F +   F P RF     E    + Y+PFGGG R+C G + AK+ + IF+  +    +W L N   ++   P  +P   +P K +
Sbjct:  326 VQEKVE-MGMYTPGKGLSMELLDQLKYTGCVIKETLRINPPVPGGFRVALKTFELNGYQIPKGWNVIYSICDTHDVADVFPNKEEFQPERFMSKGLEDGSRFNYIPFGGGSRMCVGKEFAKVLLKIFLVELTQHCNWILSNGPPTMKTGPTIYPVDNLPTKFT 487          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP26A_MOUSE (Cytochrome P450 26A1 OS=Mus musculus GN=Cyp26a1 PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 3.056e-21
Identity = 49/147 (33.33%), Postives = 80/147 (54.42%), Query Frame = 1
Query:  118 LTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKIS 546
            L +E ++++KY   V +E++RL PP+ G FR A+   E  G+ IPKGW V+++   TH   + F +   F+P RF     E    + ++PFGGG R C G + AK+ + IF   +    DW L+N   ++   P  +P   +P + +
Sbjct:  345 LDMETLEQLKYIGCVIKETLRLNPPVPGGFRVALKTFELNGYQIPKGWNVIYSICDTHDVADIFTNKEEFNPDRFIVPHPEDASRFSFIPFGGGLRSCVGKEFAKILLKIFTVELARHCDWQLLNGPPTMKTSPTVYPVDNLPARFT 491          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C85A1_SOLLC (Cytochrome P450 85A1 OS=Solanum lycopersicum GN=CYP85A1 PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 3.056e-21
Identity = 58/184 (31.52%), Postives = 92/184 (50.00%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPY--VYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKIS 546
            T S    M  K L  HP     L +EH+ I   K+  + +   D + +++T  V  E+ RL   + G  RK   D+E  G+ IPKGW++       + +P  + DP SF+P R+ +    +   +L FGGG R C G +L    I  F+HY VT+Y W  I  ++ +    +  P+ G+ I++S
Sbjct:  280 TVSTTSMMAVKYLHDHPKVLEELRKEHMAIREKKKPEDPIDYNDYRSMRFTRAVILETSRLATIVNGVLRKTTQDMEINGYIIPKGWRIYVYTRELNYDPRLYPDPYSFNPWRWMDKSLEHQNSFLVFGGGTRQCPGKELGVAEISTFLHYFVTKYRWEEIGGDKLMKFPRVEAPN-GLRIRVS 462          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C72B2_PINTA (Cytochrome P450 720B2 OS=Pinus taeda GN=CYP720B2 PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 3.056e-21
Identity = 65/194 (33.51%), Postives = 104/194 (53.61%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEI----LTLEDMKKIKYTWQVARESMRL--FPPIFGSFRKAVSDIEYEG-FTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE------ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKI 543
            T+S +++   K L   P     L  EH  ++  KR G +    L  +D + +K+T  V  E++R+  F P  G FR+   DI+ +G F IP+GW V     GTH + +Y    L FDP R++      E +    ++PFGGG RLC G  LAK+ + +F+H  VT++ W  +  ++ I+  P P   +G+PI++
Sbjct:  295 TSSRSMSFAIKFLTDCPRALEELKAEHDALL--KRKGNLKNQKLNWDDYQSLKFTQCVIHETLRVGNFGP--GVFRETKEDIKTKGGFVIPRGWTVYVFLTGTHLDEKYHSSALKFDPWRWQPHLQDQELLKNPSFMPFGGGARLCPGMHLAKMELALFLHNFVTKFRWEALQ-DDKISYFPFPRLIKGLPIRL 483          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C85A_PHAVU (Cytochrome P450 85A OS=Phaseolus vulgaris GN=BA13 PE=3 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 1.517e-20
Identity = 58/184 (31.52%), Postives = 91/184 (49.46%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF--EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKIS 546
            T S    M  K L  HP     + +EH  I   K+  + +   D+K +++T  V  E+ RL   + G  RK   D+E  G+ IPKGW++       + +P  + DPL+F+P R+          +L FGGG R C G +L    I  F+HY VTRY W  +  ++ +    +  P+ G+ I++S
Sbjct:  280 TVSTTSMMAVKYLHDHPKVLEEIRKEHFAIRERKKPEDPIDCNDLKSMRFTRAVIFETSRLATIVNGVLRKTTHDMELNGYLIPKGWRIYVYTREINYDPFLYHDPLTFNPWRWLGNSLESQSHFLIFGGGTRQCPGKELGIAEISTFLHYFVTRYRWEEVGGDKLMKFPRVVAPN-GLHIRVS 462          
The following BLAST results are available for this feature:
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 275
Match NameE-valueIdentityDescription
C72B1_PINTA2.764e-2232.80Abietadienol/abietadienal oxidase OS=Pinus taeda G... [more]
C90D2_ORYSJ3.610e-2234.25Cytochrome P450 90D2 OS=Oryza sativa subsp. japoni... [more]
C85A3_SOLLC1.050e-2133.15Cytochrome P450 85A3 OS=Solanum lycopersicum GN=CY... [more]
C85A1_ORYSJ1.792e-2131.15Cytochrome P450 85A1 OS=Oryza sativa subsp. japoni... [more]
CP26A_HUMAN2.340e-2134.01Cytochrome P450 26A1 OS=Homo sapiens GN=CYP26A1 PE... [more]
CP26A_DANRE2.340e-2133.74Cytochrome P450 26A1 OS=Danio rerio GN=cyp26a1 PE=... [more]
CP26A_MOUSE3.056e-2133.33Cytochrome P450 26A1 OS=Mus musculus GN=Cyp26a1 PE... [more]
C85A1_SOLLC3.056e-2131.52Cytochrome P450 85A1 OS=Solanum lycopersicum GN=CY... [more]
C72B2_PINTA3.056e-2133.51Cytochrome P450 720B2 OS=Pinus taeda GN=CYP720B2 P... [more]
C85A_PHAVU1.517e-2031.52Cytochrome P450 85A OS=Phaseolus vulgaris GN=BA13 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00180 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00180 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623089 ID=BQ623089|Name=BQ623089|organism=Citrus sinensis|type=EST|length=604bp
ACCACATCTTTTGCCATTGCCATGACGTTTAAGATGTTAGCGCAGCATCC
AGATTGCTATTCTCTCCTCCTACAAGAACATGTTAACATAATGAATAATA
AAAGAGCTGGCGAAATTCTAACACTGGAAGACATGAAGAAGATAAAATAC
ACCTGGCAAGTTGCTCGCGAAAGCATGCGGCTCTTCCCTCCCATCTTCGG
CTCCTTCAGAAAAGCAGTTTCTGACATTGAGTATGAGGGATTCACCATTC
CTAAAGGCTGGAAGGTTTTATGGACAGCATTTGGAACACATTCGAATCCG
GAGTATTTTGAAGATCCTCTGAGTTTCGATCCCAGAAGGTTCGAGGAATC
AGTGCCTCCATATGTCTATCTTCCATTCGGAGGAGGGCCAAGATTGTGCG
CAGGCTACCAACTGGCCAAGCTAAACATCATCATCTTTGTTCATTATGTT
GTAACTCGCTATGATTGGTCTTTAATTAATCCCAACGAGTCAATCACCAT
GGATCCTCTCCCATTTCCTTCCCAAGGAATGCCCATCAAGATTTCTCCCA
AGTTGTAAACAACCAGCAATACGGCTGGGATTTTTCCTTACATAATTATG
TTGG
back to top