BQ623089

Overview
NameBQ623089
Unique NameBQ623089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4D2_DROME (Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2)

HSP 1 Score: 98.9821 bits (245), Expect = 1.981e-20
Identity = 58/187 (31.02%), Postives = 94/187 (50.27%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVP---PYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKISPK 552
            TT+ AI+     +++HP+    L QE  +++   R   + TL D+ ++K+   V +ES+RL PP+    R    D+E  G  IP G       F    +PEYFE P  F P RF+  VP   PY Y+PF  GPR C G + A L +   V  ++  ++   + P    +M+ +   + G+ + + P+
Sbjct:  315 TTTSAISFCLYEISRHPEVQQRLQQEIRDVLGEDRKSPV-TLRDLGELKFMENVIKESLRLHPPVPMIGRWFAEDVEIRGKHIPAGTNFTMGIFVLLRDPEYFESPDEFRPERFDADVPQIHPYAYIPFSAGPRNCIGQKFAMLEMKSTVSKLLRHFELLPLGPEPRHSMNIVLRSANGVHLGLKPR 500          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP3A6_RABIT (Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2)

HSP 1 Score: 97.4413 bits (241), Expect = 5.764e-20
Identity = 56/181 (30.94%), Postives = 93/181 (51.38%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGM 531
            TTS  ++    +LA HPD    L +E   ++ NK   E+ T + + K++Y   V  E++RL+P      R    D++  G  IPKG  V+   +  H +P+++ +P  F P RF    ++++ PY+Y PFG GPR C G + A +NI + +  ++  + + L       T  PL    QG+
Sbjct:  307 TTSSTLSFIMHLLATHPDVQQKLQEEIDTLLPNK---ELATYDTLVKMEYLDMVVNETLRLYPIAGRLERVCKKDVDINGTFIPKGTIVMMPTYALHRDPQHWTEPDEFRPERFSKKNKDNINPYIYHPFGAGPRNCLGMRFALMNIKLALVRLMQNFSFKLCKE----TQVPLKLGKQGL 480          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP3AD_MOUSE (Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 7.528e-20
Identity = 60/181 (33.15%), Postives = 93/181 (51.38%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGM 531
            TTS A++    +LA HPD    L  E    + NK      T + + +++Y   V  E++RL+P      R   +D+E  G  IPKG  V+   F  H +P+Y+ +P  F P RF    ++S+ PY+YLPFG GPR C G + A +N+ + +  V+  +    + P +  T  PL    QG+
Sbjct:  309 TTSSALSFALYLLAIHPDVQKKLQDEIDAALPNKAPA---TYDTLLQMEYLDMVVNETLRLYPIAGRLERVCKTDVEINGLFIPKGTVVMIPTFALHKDPKYWPEPEEFRPERFSKKNQDSINPYMYLPFGSGPRNCIGMRFALINMKVALVRVLQNF---TVQPCKE-TEIPLKLSKQGL 482          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP3A5_HUMAN (Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 9.832e-20
Identity = 58/180 (32.22%), Postives = 91/180 (50.56%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF---EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGM 531
            TTS  ++ T   LA HPD    L +E   ++ NK      T + + +++Y   V  E++RLFP      R    D+E  G  IPKG  V+   +  H +P+Y+ +P  F P RF   ++S+ PY+Y PFG GPR C G + A +N+ + +  V+  + +         T  PL   +QG+
Sbjct:  309 TTSSVLSFTLYELATHPDVQQKLQKEIDAVLPNKAPP---TYDAVVQMEYLDMVVNETLRLFPVAIRLERTCKKDVEINGVFIPKGSMVVIPTYALHHDPKYWTEPEEFRPERFSKKKDSIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKE----TQIPLKLDTQGL 481          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP3AJ_CAPAE (Cytochrome P450 3A19 (Fragment) OS=Capra aegagrus GN=CYP3A19 PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.284e-19
Identity = 59/191 (30.89%), Postives = 96/191 (50.26%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNE---SITMDPLPFPSQGMPIKISPK 552
            TTS +++     LA HPD    L +E      NK      T + + +++Y   V  E++R+FP      R    D+E  G +IPKG  V+   F  H+NPE++ +P  F P RF    ++ + PYVYLPFG GPR C G + A +NI + +  ++  + +      +    +    L  P Q + +K++P+
Sbjct:   20 TTSTSLSFIIYELATHPDVQQKLQEEIDATFPNKAPP---TYDALVQMEYLDMVVNETLRMFPIAGRLERLCKKDVEIHGVSIPKGTTVMVPLFVLHNNPEFWPEPEEFRPERFSKKNKDGINPYVYLPFGTGPRNCVGMRFALMNIKLALVRILQNFSFIPCKETQIPLKLYTQGLTQPEQPVILKVAPR 207          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP3A9_RAT (Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2)

HSP 1 Score: 96.2857 bits (238), Expect = 1.284e-19
Identity = 58/181 (32.04%), Postives = 90/181 (49.72%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGM 531
            TTS A++    +LA HPD    L  E    + NK      T + + +++Y   V  E++RL+P      R   +D+E  G  IPKG  V+   F  H +P Y+ +P  F P RF    ++++ PY+YLPFG GPR C G + A +N+ + +  V+  + +         T  PL    QG+
Sbjct:  309 TTSSALSFVLYLLAIHPDIQKKLQDEIDAALPNKAHA---TYDTLLQMEYLDMVVNETLRLYPIAGRLERVCKTDVEINGVFIPKGTVVMIPTFALHKDPHYWPEPEEFRPERFSKKNQDNINPYMYLPFGNGPRNCIGMRFALMNMKVALFRVLQNFSFQPCKE----TQIPLKLSKQGL 482          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP3AB_MOUSE (Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 2.861e-19
Identity = 57/181 (31.49%), Postives = 89/181 (49.17%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEE----SVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGM 531
            TTS  ++ T   LA HPD    L  E    + NK      T + + +++Y   V  E++RL+P      R    D+E  G  IPKG  V+  ++  H +P+++ +P  F P RF +    S+ PYVYLPFG GPR C G + A +N+ + +  ++  + +         T  PL    QG+
Sbjct:  310 TTSSTLSFTLHSLATHPDIQKKLQDEIDEALPNKAPP---TYDTVMEMEYLDMVLNETLRLYPIANRLERVCKKDVELNGVYIPKGSTVMIPSYALHHDPQHWSEPEEFQPERFSKENKGSIDPYVYLPFGNGPRNCLGMRFALMNMKLALTKIMQNFSFQPCKE----TQIPLKLSRQGL 483          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP3AP_MOUSE (Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 3.736e-19
Identity = 60/190 (31.58%), Postives = 96/190 (50.53%), Query Frame = 1
Query:    4 TSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEE----SVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNE------SITMDPLPFPSQGMPIKI 543
            TS +I++    LA HPD    L  E    + NK     +T + +  ++Y   V  ES+RL+P      R +  D+E  G  IPKG  V+   +  H NPEY+ +P  F P RF +    ++ PY+Y+PFG GPR C G + A ++I + V  V+  +    + P E       I+ +P+  P + + +K+
Sbjct:  310 TSTSISLIMYELATHPDVQKKLQDEIDRTLPNKAP---VTYDALMDMEYLDMVVNESLRLYPIAIRLERVSKKDVEINGVFIPKGTVVMIPIYPLHRNPEYWPEPQEFCPERFSKENKGNIDPYIYMPFGNGPRNCIGMRFALISIKLAVIGVLQNF---TVQPCEETQIPLKISREPIFQPEKPIILKV 493          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP136_MYCTU (Putative cytochrome P450 136 OS=Mycobacterium tuberculosis GN=cyp136 PE=3 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 6.373e-19
Identity = 61/191 (31.94%), Postives = 93/191 (48.69%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF-----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMD--PLPFPSQGMPIKISPK 552
            +TS A  M ++ LA HP+      Q+     +++     L +E +++++    V  ES+RL  P+  + R+ V D E  G+ +PKG  V+      H  PE + DPL+FDP RF     E     Y + PFGGG   C G    +L I   +H ++ RY   L  P+     D   +P P  GMPI + P+
Sbjct:  308 STSTATTMAYQ-LAAHPEW-----QQRCRDESDRHGDGPLDIESLEQLESLDLVMNESIRLVTPVQWAMRQTVRDTELLGYYLPKGTNVIAYPGMNHRLPEIWTDPLTFDPERFTEPRNEHKRHRYAFTPFGGGVHKCIGMVFDQLEIKTILHRLLRRYRLELSRPDYQPRWDYSAMPIPMDGMPIVLRPR 492          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP3AS_BOVIN (Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.420e-18
Identity = 60/191 (31.41%), Postives = 92/191 (48.17%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNE---SITMDPLPFPSQGMPIKISPK 552
            TTS  ++     L  HP     L +E      NK      T + + +++Y   V  E++R+FP      R    D+E  G TIPKG  VL   F  H+NPE + +P  F P RF    ++S+ PYVYLPFG GPR C G + A +NI + +  ++  + +      +    +    L  P Q + +K+ P+
Sbjct:  309 TTSSTLSFIIYELTTHPHVQQKLQEEIDATFPNKAPP---TYDALVQMEYLDMVVNETLRMFPIAGRLERVCKKDVEIHGVTIPKGTTVLVPLFVLHNNPELWPEPEEFRPERFSKNNKDSINPYVYLPFGTGPRNCLGMRFAIMNIKLALVRILQNFSFKPCKETQIPLKLYTQGLTQPEQPVILKVVPR 496          
The following BLAST results are available for this feature:
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 275
Match NameE-valueIdentityDescription
CP4D2_DROME1.981e-2031.02Cytochrome P450 4d2 OS=Drosophila melanogaster GN=... [more]
CP3A6_RABIT5.764e-2030.94Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CY... [more]
CP3AD_MOUSE7.528e-2033.15Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE... [more]
CP3A5_HUMAN9.832e-2032.22Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1... [more]
CP3AJ_CAPAE1.284e-1930.89Cytochrome P450 3A19 (Fragment) OS=Capra aegagrus ... [more]
CP3A9_RAT1.284e-1932.04Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9... [more]
CP3AB_MOUSE2.861e-1931.49Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE... [more]
CP3AP_MOUSE3.736e-1931.58Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE... [more]
CP136_MYCTU6.373e-1931.94Putative cytochrome P450 136 OS=Mycobacterium tube... [more]
CP3AS_BOVIN1.420e-1831.41Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00180 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00180 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623089 ID=BQ623089|Name=BQ623089|organism=Citrus sinensis|type=EST|length=604bp
ACCACATCTTTTGCCATTGCCATGACGTTTAAGATGTTAGCGCAGCATCC
AGATTGCTATTCTCTCCTCCTACAAGAACATGTTAACATAATGAATAATA
AAAGAGCTGGCGAAATTCTAACACTGGAAGACATGAAGAAGATAAAATAC
ACCTGGCAAGTTGCTCGCGAAAGCATGCGGCTCTTCCCTCCCATCTTCGG
CTCCTTCAGAAAAGCAGTTTCTGACATTGAGTATGAGGGATTCACCATTC
CTAAAGGCTGGAAGGTTTTATGGACAGCATTTGGAACACATTCGAATCCG
GAGTATTTTGAAGATCCTCTGAGTTTCGATCCCAGAAGGTTCGAGGAATC
AGTGCCTCCATATGTCTATCTTCCATTCGGAGGAGGGCCAAGATTGTGCG
CAGGCTACCAACTGGCCAAGCTAAACATCATCATCTTTGTTCATTATGTT
GTAACTCGCTATGATTGGTCTTTAATTAATCCCAACGAGTCAATCACCAT
GGATCCTCTCCCATTTCCTTCCCAAGGAATGCCCATCAAGATTTCTCCCA
AGTTGTAAACAACCAGCAATACGGCTGGGATTTTTCCTTACATAATTATG
TTGG
back to top