BQ623186

Overview
NameBQ623186
Unique NameBQ623186
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length610
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12 contig Csv1_Contig12:1..610. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC6_ARATH (Rac-like GTP-binding protein ARAC6 OS=Arabidopsis thaliana GN=ARAC6 PE=1 SV=2)

HSP 1 Score: 308.531 bits (789), Expect = 1.665e-83
Identity = 147/167 (88.02%), Postives = 159/167 (95.21%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKR 605
            +ISYTSNTFPTDYVPTVFDNFSANVVV+G+TVNLGLWDTAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENV+KKWIPEL+HYAPGVPI+LVGTKLDLRDDKQF  DHPGAVPITT QGEEL+KLIGAP YIECSSK+Q+NVK VFDAAI+VVLQPPK  KKK +
Sbjct:   23 LISYTSNTFPTDYVPTVFDNFSANVVVNGATVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHPGAVPITTVQGEELKKLIGAPAYIECSSKSQENVKGVFDAAIRVVLQPPKQKKKKNK 189          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC2_LOTJA (Rac-like GTP-binding protein RAC2 OS=Lotus japonicus GN=RAC2 PE=2 SV=1)

HSP 1 Score: 306.99 bits (785), Expect = 4.843e-83
Identity = 147/167 (88.02%), Postives = 160/167 (95.81%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKR 605
            +ISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSL+S+ASYEN++KKWIPELRHYAP VPI+LVGTKLDLR+D+Q+L DHPGA PITTAQGEEL+K IGA VY+ECSSKTQQNVKAVFDAAIKVVLQPPK  KK+K+
Sbjct:   23 LISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLLSRASYENISKKWIPELRHYAPTVPIVLVGTKLDLREDRQYLIDHPGATPITTAQGEELKKAIGAAVYLECSSKTQQNVKAVFDAAIKVVLQPPKPKKKRKK 189          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC2_ARATH (Rac-like GTP-binding protein ARAC2 OS=Arabidopsis thaliana GN=ARAC2 PE=1 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 5.920e-81
Identity = 145/166 (87.35%), Postives = 155/166 (93.37%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            +ISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKW+PEL+HYAPG+PI+LVGTKLDLRDDKQFL DHPGA  ITTAQGEELRK+IGA  Y+ECSSKTQQNVKAVFD AI+V L+PPK  KK K
Sbjct:   23 LISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIHKKWLPELKHYAPGIPIVLVGTKLDLRDDKQFLKDHPGAASITTAQGEELRKMIGAVRYLECSSKTQQNVKAVFDTAIRVALRPPKAKKKIK 188          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC13_GOSHI (Rac-like GTP-binding protein RAC13 OS=Gossypium hirsutum GN=RAC13 PE=2 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 1.010e-80
Identity = 145/168 (86.31%), Postives = 156/168 (92.86%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKRR 608
            +ISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKWIPELRHYA  VP++LVGTKLDLRDDKQFL DHPGA PI+T+QGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKV L+PPK  +K  +R
Sbjct:   23 LISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIYKKWIPELRHYAHNVPVVLVGTKLDLRDDKQFLIDHPGATPISTSQGEELKKMIGAVTYIECSSKTQQNVKAVFDAAIKVALRPPKPKRKPCKR 190          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC9_GOSHI (Rac-like GTP-binding protein RAC9 OS=Gossypium hirsutum GN=RAC9 PE=2 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 2.250e-80
Identity = 144/168 (85.71%), Postives = 157/168 (93.45%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKRR 608
            +ISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLIS+ASYENV KKWIPELRHYAP VPI+LVGTKLDLRDDKQFL+D+PGA+ ITT+QGEEL+K+IGA  YIECSSKTQQNVKAVFD AIK+ L+PPK  +K  +R
Sbjct:   23 LISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISRASYENVHKKWIPELRHYAPNVPIVLVGTKLDLRDDKQFLSDNPGAISITTSQGEELKKMIGAVTYIECSSKTQQNVKAVFDVAIKIALRPPKPKRKPIKR 190          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC7_ORYSJ (Rac-like GTP-binding protein 7 OS=Oryza sativa subsp. japonica GN=RAC7 PE=2 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 3.837e-80
Identity = 143/168 (85.12%), Postives = 155/168 (92.26%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKRR 608
            +ISYTSNTFPTDYVPTVFDNFSANVVVDG+TVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKWIPELRHYAP VPI+LVGTKLDLR+DKQF  DHPG  PI+TAQGEEL+++IGA  YIECSSKTQQNVK+VFD+AIKVVL PPK  KK  R+
Sbjct:   23 LISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIHKKWIPELRHYAPNVPIVLVGTKLDLREDKQFFLDHPGLAPISTAQGEELKRMIGAAAYIECSSKTQQNVKSVFDSAIKVVLCPPKPKKKNTRK 190          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC1_ORYSJ (Rac-like GTP-binding protein 1 OS=Oryza sativa subsp. japonica GN=RAC1 PE=1 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 1.253e-79
Identity = 131/168 (77.98%), Postives = 150/168 (89.29%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKN---TKKK 599
            +I YT N FPTDY+PTVFDNFSANV VDGS VNLGLWDTAGQEDY+RLRPLSYRGADVF+L+FSLIS+ASYENV KKW+PELR +APGVP++LVGTKLDLR+D+ +LADHP +  ITT QGEELRKLIGA  YIECSSKTQ+N+KAVFD AIKVVLQPP++   T+KK
Sbjct:   27 LICYTCNKFPTDYIPTVFDNFSANVSVDGSVVNLGLWDTAGQEDYSRLRPLSYRGADVFILSFSLISRASYENVQKKWMPELRRFAPGVPVVLVGTKLDLREDRAYLADHPASSIITTEQGEELRKLIGAVAYIECSSKTQRNIKAVFDTAIKVVLQPPRHKDVTRKK 194          

HSP 2 Score: 44.669 bits (104), Expect = 1.253e-79
Identity = 19/21 (90.48%), Postives = 21/21 (100.00%), Query Frame = 2
Query:   41 SASRFIKCVTVGDGAVGKTCM 103
            +A+RFIKCVTVGDGAVGKTCM
Sbjct:    6 AATRFIKCVTVGDGAVGKTCM 26          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC3_ORYSJ (Rac-like GTP-binding protein 3 OS=Oryza sativa subsp. japonica GN=RAC3 PE=2 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 1.612e-78
Identity = 136/168 (80.95%), Postives = 154/168 (91.67%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKRR 608
            +I YTSN FPTDY+PTVFDNFSANVVVD +TVNLGLWDTAGQEDYNRLRPLSYRGADVF+LAFSL+S+ASYEN+ KKWIPEL+HYAPGVPI+LVGTKLDLR+DK +L DHPG +P+TTAQGEELRK IGA  YIECSSKTQQNVK VFDAAIKVV+QPP   ++KK++
Sbjct:   25 LICYTSNKFPTDYIPTVFDNFSANVVVDSTTVNLGLWDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENIMKKWIPELQHYAPGVPIVLVGTKLDLREDKHYLLDHPGMIPVTTAQGEELRKQIGAAYYIECSSKTQQNVKGVFDAAIKVVIQPPTKQREKKKK 192          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC4_ORYSJ (Rac-like GTP-binding protein 4 OS=Oryza sativa subsp. japonica GN=RAC4 PE=2 SV=1)

HSP 1 Score: 290.812 bits (743), Expect = 3.592e-78
Identity = 141/171 (82.46%), Postives = 156/171 (91.23%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPP---KNTKKKKRR 608
            +I YTSN FPTDYVPTVFDNFSANVVVDG+TVNLGLWDTAGQEDYNRLRPLSYRGADVF+LAFSL+S+ASYENV KKW+PEL+HYAPGVPI+LVGTKLDLR+DK +L DHP  VP+TTAQGEELRK IGA  YIECSSKTQQNVKAVFDAAIKVV++PP   ++ KKKK R
Sbjct:   25 LICYTSNKFPTDYVPTVFDNFSANVVVDGTTVNLGLWDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENVMKKWLPELQHYAPGVPIVLVGTKLDLREDKHYLLDHPSLVPVTTAQGEELRKHIGATCYIECSSKTQQNVKAVFDAAIKVVIKPPTKQRDRKKKKTR 195          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC10_ARATH (Rac-like GTP-binding protein ARAC10 OS=Arabidopsis thaliana GN=ARAC10 PE=1 SV=1)

HSP 1 Score: 284.648 bits (727), Expect = 2.574e-76
Identity = 136/172 (79.07%), Postives = 157/172 (91.28%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQP----PKNTKKKKRR 608
            +I YTSN FPTDY+PTVFDNFSANVVV+G+TVNLGLWDTAGQEDYNRLRPLSYRGADVF+L+FSL+S+ASYENV KKWIPEL+H+APGVP++LVGTKLDLR+DK +LADHPG  P+TTAQGEELRKLIGA  YIECSSKTQQNVKAVFD+AIK V++P     + TKKKK++
Sbjct:   25 LICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSYRGADVFVLSFSLVSRASYENVFKKWIPELQHFAPGVPLVLVGTKLDLREDKHYLADHPGLSPVTTAQGEELRKLIGATYYIECSSKTQQNVKAVFDSAIKEVIKPLVKQKEKTKKKKKQ 196          
The following BLAST results are available for this feature:
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RAC6_ARATH1.665e-8388.02Rac-like GTP-binding protein ARAC6 OS=Arabidopsis ... [more]
RAC2_LOTJA4.843e-8388.02Rac-like GTP-binding protein RAC2 OS=Lotus japonic... [more]
RAC2_ARATH5.920e-8187.35Rac-like GTP-binding protein ARAC2 OS=Arabidopsis ... [more]
RAC13_GOSHI1.010e-8086.31Rac-like GTP-binding protein RAC13 OS=Gossypium hi... [more]
RAC9_GOSHI2.250e-8085.71Rac-like GTP-binding protein RAC9 OS=Gossypium hir... [more]
RAC7_ORYSJ3.837e-8085.12Rac-like GTP-binding protein 7 OS=Oryza sativa sub... [more]
RAC1_ORYSJ1.253e-7977.98Rac-like GTP-binding protein 1 OS=Oryza sativa sub... [more]
RAC3_ORYSJ1.612e-7880.95Rac-like GTP-binding protein 3 OS=Oryza sativa sub... [more]
RAC4_ORYSJ3.592e-7882.46Rac-like GTP-binding protein 4 OS=Oryza sativa sub... [more]
RAC10_ARATH2.574e-7679.07Rac-like GTP-binding protein ARAC10 OS=Arabidopsis... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00277 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00277 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623186 ID=BQ623186|Name=BQ623186|organism=Citrus sinensis|type=EST|length=610bp
GTAATAAAGATACTGTCTTAAGTGCACGTGGCGCGAGATGAGTGCATCGA
GGTTCATAAAGTGCGTGACGGTCGGTGACGGCGCCGTCGGCAAGACTTGC
ATGCGTCATTTCTTACACCAGCAACACTTTCCCGACGGATTATGTGCCAA
CAGTATTTGACAATTTCAGTGCAAATGTGGTAGTGGATGGAAGCACTGTT
AATCTTGGGTTGTGGGACACTGCAGGCCAGGAAGATTACAATAGACTAAG
ACCATTGAGCTACCGCGGGGCAGATGTCTTCTTACTCGCATTCTCTCTCA
TTAGCAAGGCCAGCTATGAAAATGTTGCTAAGAAATGGATTCCTGAGTTG
AGGCATTATGCACCTGGTGTTCCAATAATTCTTGTCGGGACGAAGCTCGA
TCTTCGGGATGATAAGCAGTTCCTTGCAGATCACCCTGGTGCAGTGCCAA
TTACCACGGCCCAAGGGGAGGAATTGAGAAAGTTGATAGGTGCTCCTGTT
TACATTGAGTGTAGTTCCAAAACACAACAGAATGTGAAAGCTGTCTTTGA
TGCGGCCATCAAGGTGGTTCTCCAGCCGCCAAAGAACACGAAGAAAAAGA
AGAGAAGGCC
back to top