BQ623186

Overview
NameBQ623186
Unique NameBQ623186
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length610
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12 contig Csv1_Contig12:1..610. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOB_HUMAN (Rho-related GTP-binding protein RhoB OS=Homo sapiens GN=RHOB PE=1 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 2.355e-37
Identity = 76/159 (47.80%), Postives = 104/159 (65.41%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQ 575
            +I ++ + FP  YVPTVF+N+ A++ VDG  V L LWDTAGQEDY+RLRPLSY   DV L+ FS+ S  S EN+ +KW+PE++H+ P VPIILV  K DLR D+    +       P+ T  G  +   I A  Y+ECS+KT++ V+ VF+ A +  LQ
Sbjct:   22 LIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQ 180          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOB_BOVIN (Rho-related GTP-binding protein RhoB OS=Bos taurus GN=RHOB PE=2 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 2.355e-37
Identity = 76/159 (47.80%), Postives = 104/159 (65.41%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQ 575
            +I ++ + FP  YVPTVF+N+ A++ VDG  V L LWDTAGQEDY+RLRPLSY   DV L+ FS+ S  S EN+ +KW+PE++H+ P VPIILV  K DLR D+    +       P+ T  G  +   I A  Y+ECS+KT++ V+ VF+ A +  LQ
Sbjct:   22 LIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQ 180          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RACG_DICDI (Rho-related protein racG OS=Dictyostelium discoideum GN=racG PE=3 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 9.493e-36
Identity = 75/174 (43.10%), Postives = 110/174 (63.22%), Query Frame = 3
Query:   93 RLACVISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL--ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKRR 608
            + + ++SYTSN+   +Y PTVFDN+S  ++ +    NL LWDTAGQE++++LR LSY   DVFLL FSLI+ +S+ N+   W+ EL    P  PI+LVGT++DL+ +   L        +PI+T QG EL K I A  ++ECS+ TQ+N+  VF+ AI       K   K+K++
Sbjct:   16 KTSMLLSYTSNSISNEYQPTVFDNYSTLLMHNKKPYNLSLWDTAGQEEFSKLRRLSYPQTDVFLLCFSLINPSSFSNILDSWVQELNENCPNTPIVLVGTQMDLKSNSVILDRLCEKKQLPISTQQGIELSKKINAFDFVECSALTQKNLHLVFEKAIDACEAHQKCQSKEKKK 189          

HSP 2 Score: 23.0978 bits (48), Expect = 9.493e-36
Identity = 9/16 (56.25%), Postives = 11/16 (68.75%), Query Frame = 2
Query:   56 IKCVTVGDGAVGKTCM 103
            IK   VG+G +GKT M
Sbjct:    4 IKVCVVGEGGIGKTSM 19          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOF_HUMAN (Rho-related GTP-binding protein RhoF OS=Homo sapiens GN=RHOF PE=2 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.292e-35
Identity = 73/174 (41.95%), Postives = 112/174 (64.37%), Query Frame = 3
Query:   93 RLACVISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGA--VPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKRR 608
            + + ++ Y+  +FP  Y P+VF+ ++A+V V    V L L+DTAGQEDY+RLRPLSY+   + L+ + +++  SY+NV  KW PE+ H+  G+P++L+G K DLR DK+ L     A   PIT  QG    + I A +Y+ECS+K ++NV+ VF  A KV L   K  +++K+R
Sbjct:   32 KTSLLMVYSQGSFPEHYAPSVFEKYTASVTVGSKEVTLNLYDTAGQEDYDRLRPLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRKLRAAQLEPITYMQGLSACEQIRAALYLECSAKFRENVEDVFREAAKVALSALKKAQRQKKR 205          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOF_BOVIN (Rho-related GTP-binding protein RhoF OS=Bos taurus GN=RHOF PE=2 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.292e-35
Identity = 72/173 (41.62%), Postives = 112/173 (64.74%), Query Frame = 3
Query:   93 RLACVISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGA--VPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKR 605
            + + ++ Y+  +FP  Y P+VF+ ++A+V V    V L L+DTAGQEDY+RLRPLSY+   + L+ + +++  SY+NV  KW PE+ H+  G+P++L+G K DLR DK+ L     A   PIT  QG+   + I A +Y+ECS+K ++NV+ VF  A KV L   K  +++K+
Sbjct:   36 KTSLLMVYSQGSFPEHYAPSVFEKYTASVTVGSKEVTLNLYDTAGQEDYDRLRPLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRKLRAAQLEPITYTQGQSACEQIRAALYLECSAKFRENVEDVFREAAKVALSALKKAQRQKQ 208          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHO5_SCHPO (GTP-binding protein rho5 OS=Schizosaccharomyces pombe GN=rho5 PE=2 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 1.688e-35
Identity = 77/173 (44.51%), Postives = 110/173 (63.58%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVL------QPPKNTKKK 599
            +I ++  TFP  YVPTVF+N+ A+V VDG  + L LWDTAGQEDY+RLRPLSY  + V L+ FS+ +  S +NV +KWI E+ H+   +PI+LVG K+DLR+D + + +       PIT  +G+ + + IGA  Y+ECS+K  + V  VF+ A +  +        PK  KKK
Sbjct:   23 LIVFSKGTFPEVYVPTVFENYVADVEVDGRHIELALWDTAGQEDYDRLRPLSYPDSHVVLICFSVDAPESLDNVQEKWISEVLHFCSNLPILLVGCKVDLRNDPKTIEELSKTSQKPITFEEGQVVAQKIGAYKYLECSAKLNEGVNEVFETAARASMLKFKPASVPKTKKKK 195          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHO_DISOM (Ras-like GTP-binding protein O-RHO OS=Discopyge ommata PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 3.760e-35
Identity = 76/166 (45.78%), Postives = 106/166 (63.86%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDD--KQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKK 596
            +I ++ + FP  YVPTVF+N+ A++ VDG  V L LWDTAGQEDY+RLRPLSY   DV L+ FS+ S  S EN+ +KW PE++H+ P +PIILVG K    D+  ++ LA      P+     +E+   I A  Y+ECS+KT++ V+ VF+ A +  LQ  K   K
Sbjct:   22 LIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNIPIILVGNKKTAGDEHTRRELAKMK-QEPVKPDDAKEMGSRIKAFGYLECSAKTKEGVREVFELASRAALQAKKTKSK 186          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOD_MOUSE (Rho-related GTP-binding protein RhoD OS=Mus musculus GN=Rhod PE=2 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 4.157e-34
Identity = 67/162 (41.36%), Postives = 105/162 (64.81%), Query Frame = 3
Query:   93 RLACVISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVL 572
            + + ++ +    FP  Y PTVF+ ++A + + G  V+L +WDTAGQ+DY+RLRPL Y  A+V LL F + +  S++NV+ +W PE+ H+  GVPII+VG K+DLR DK  + +       P+T  +G ++ + +GA  Y+ECS++   NV+AVF  A +V L
Sbjct:   30 KTSLMMVFAKGAFPESYSPTVFERYNATLQMKGKPVHLQIWDTAGQDDYDRLRPLFYPDANVLLLCFDVTNPNSFDNVSNRWYPEVTHFCKGVPIIVVGCKIDLRKDKVLVNNLRKKRLEPVTYHRGHDMARSVGAVAYLECSARLHDNVEAVFQEAAEVAL 191          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOF_MOUSE (Rho-related GTP-binding protein RhoF OS=Mus musculus GN=Rhof PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 7.092e-34
Identity = 70/173 (40.46%), Postives = 108/173 (62.43%), Query Frame = 3
Query:   93 RLACVISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGA--VPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKR 605
            + + ++ Y   +FP  Y P+VF+ ++A+V V    V L L+DTAGQEDY+RLRPLSY+   + L+ + +++  SY+NV  KW PE+ H+  G+P +L+G K DLR DK+ L     A   PIT  QG    + +   +Y+ECS+K ++NV+ VF  A KV L   K  +++K+
Sbjct:   32 KTSLLMVYCQGSFPEHYAPSVFEKYTASVTVGNKEVTLNLYDTAGQEDYDRLRPLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHFCRGIPTVLIGCKTDLRKDKEQLRKLRAAQLEPITYTQGLNACEQMRGALYLECSAKFRENVEDVFREAAKVALSALKKAQRQKK 204          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHO4_YEAST (GTP-binding protein RHO4 OS=Saccharomyces cerevisiae GN=RHO4 PE=1 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 7.092e-34
Identity = 70/157 (44.59%), Postives = 104/157 (66.24%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVV-VDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVL 572
            +ISY   TFPTDY+PT+F+N+  N+   +G  + L LWDTAGQE+Y+RLRPLSY  ADV ++ +S+ SK S +NV   W PE++H+ P  PI+LVG K DL     + AD+   + +  +  E L K +GA  +I+CS++ ++N+  VF+ AI  +L
Sbjct:   89 LISYVQGTFPTDYIPTIFENYVTNIEGPNGQIIELALWDTAGQEEYSRLRPLSYTNADVLMVCYSVGSKTSLKNVEDLWFPEVKHFCPSTPIMLVGLKSDL-----YEADNLSDL-VEPSSAESLAKRLGAFAHIQCSARLKENIDEVFETAIHTLL 239          
The following BLAST results are available for this feature:
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RHOB_HUMAN2.355e-3747.80Rho-related GTP-binding protein RhoB OS=Homo sapie... [more]
RHOB_BOVIN2.355e-3747.80Rho-related GTP-binding protein RhoB OS=Bos taurus... [more]
RACG_DICDI9.493e-3643.10Rho-related protein racG OS=Dictyostelium discoide... [more]
RHOF_HUMAN1.292e-3541.95Rho-related GTP-binding protein RhoF OS=Homo sapie... [more]
RHOF_BOVIN1.292e-3541.62Rho-related GTP-binding protein RhoF OS=Bos taurus... [more]
RHO5_SCHPO1.688e-3544.51GTP-binding protein rho5 OS=Schizosaccharomyces po... [more]
RHO_DISOM3.760e-3545.78Ras-like GTP-binding protein O-RHO OS=Discopyge om... [more]
RHOD_MOUSE4.157e-3441.36Rho-related GTP-binding protein RhoD OS=Mus muscul... [more]
RHOF_MOUSE7.092e-3440.46Rho-related GTP-binding protein RhoF OS=Mus muscul... [more]
RHO4_YEAST7.092e-3444.59GTP-binding protein RHO4 OS=Saccharomyces cerevisi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00277 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00277 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623186 ID=BQ623186|Name=BQ623186|organism=Citrus sinensis|type=EST|length=610bp
GTAATAAAGATACTGTCTTAAGTGCACGTGGCGCGAGATGAGTGCATCGA
GGTTCATAAAGTGCGTGACGGTCGGTGACGGCGCCGTCGGCAAGACTTGC
ATGCGTCATTTCTTACACCAGCAACACTTTCCCGACGGATTATGTGCCAA
CAGTATTTGACAATTTCAGTGCAAATGTGGTAGTGGATGGAAGCACTGTT
AATCTTGGGTTGTGGGACACTGCAGGCCAGGAAGATTACAATAGACTAAG
ACCATTGAGCTACCGCGGGGCAGATGTCTTCTTACTCGCATTCTCTCTCA
TTAGCAAGGCCAGCTATGAAAATGTTGCTAAGAAATGGATTCCTGAGTTG
AGGCATTATGCACCTGGTGTTCCAATAATTCTTGTCGGGACGAAGCTCGA
TCTTCGGGATGATAAGCAGTTCCTTGCAGATCACCCTGGTGCAGTGCCAA
TTACCACGGCCCAAGGGGAGGAATTGAGAAAGTTGATAGGTGCTCCTGTT
TACATTGAGTGTAGTTCCAAAACACAACAGAATGTGAAAGCTGTCTTTGA
TGCGGCCATCAAGGTGGTTCTCCAGCCGCCAAAGAACACGAAGAAAAAGA
AGAGAAGGCC
back to top