BQ623186

Overview
NameBQ623186
Unique NameBQ623186
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length610
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12 contig Csv1_Contig12:1..610. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC8_ARATH (Rac-like GTP-binding protein ARAC8 OS=Arabidopsis thaliana GN=ARAC8 PE=1 SV=2)

HSP 1 Score: 281.952 bits (720), Expect = 1.668e-75
Identity = 133/168 (79.17%), Postives = 153/168 (91.07%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKRR 608
            +I YTSN FPTDY+PTVFDNFS NVVV+G TVNLGLWDTAGQEDYNRLRPLSYRGADVF+LAFSLIS+ASYENV KKWIPEL+H+APGVPI+LVGTK+DLR+D+ +L+DHPG  P+TT+QGEELRK IGA  YIECSSKTQQNVKAVFDAAIKVV++P    K+KK++
Sbjct:   25 LICYTSNKFPTDYIPTVFDNFSVNVVVEGITVNLGLWDTAGQEDYNRLRPLSYRGADVFVLAFSLISRASYENVFKKWIPELQHFAPGVPIVLVGTKMDLREDRHYLSDHPGLSPVTTSQGEELRKHIGATYYIECSSKTQQNVKAVFDAAIKVVIKPAVKQKEKKKK 192          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC2_ORYSJ (Rac-like GTP-binding protein 2 OS=Oryza sativa subsp. japonica GN=RAC2 PE=2 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 5.934e-73
Identity = 134/174 (77.01%), Postives = 149/174 (85.63%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKN------TKKKKRR 608
            +I YTSN FPTDY+PTVFDNFSANV VDG+ VNLGLWDTAGQEDY+RLRPLSYRGAD+F+LAFSLIS+ASYENV KKW+PELR +AP VPI+LVGTKLDLRD + +LADHP A  ITTAQGEELRK IGA  YIECSSKTQQN+KAVFD AIKVVLQPP+        +KK RR
Sbjct:   24 LICYTSNKFPTDYIPTVFDNFSANVSVDGNIVNLGLWDTAGQEDYSRLRPLSYRGADIFVLAFSLISRASYENVLKKWMPELRRFAPNVPIVLVGTKLDLRDHRSYLADHPAASAITTAQGEELRKQIGAAAYIECSSKTQQNIKAVFDTAIKVVLQPPRRRGETTMARKKTRR 197          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC9_ARATH (Rac-like GTP-binding protein ARAC9 OS=Arabidopsis thaliana GN=ARAC9 PE=1 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 1.322e-72
Identity = 131/168 (77.98%), Postives = 147/168 (87.50%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKRR 608
            +ISYTSNTFPTDYVPTVFDNF+ANV+VDG TVNLGLWDTAGQEDYNR+RPLSYRGADVF+LAFSLIS+ S+EN+AKKW+PELRHYAP VPI+LVGTK DLRD+ QF  ++PGA  I   QG+ELRK IGA  YIECSSK Q NVKAVFD AIKVVL PP  TKK+KR+
Sbjct:   35 LISYTSNTFPTDYVPTVFDNFNANVLVDGKTVNLGLWDTAGQEDYNRVRPLSYRGADVFILAFSLISRPSFENIAKKWVPELRHYAPTVPIVLVGTKSDLRDNMQFPKNYPGACTIFPEQGQELRKEIGALAYIECSSKAQMNVKAVFDEAIKVVLHPPSKTKKRKRK 202          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC7_ARATH (Rac-like GTP-binding protein ARAC7 OS=Arabidopsis thaliana GN=ARAC7 PE=1 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 1.462e-71
Identity = 132/168 (78.57%), Postives = 145/168 (86.31%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKRR 608
            +I YTSN FPTDY+PTVFDNFSANV VDG  VNLGLWDTAGQEDY+RLRPLSYRGAD+F+LAFSLISKASYENV KKW+PELR +AP VPI+LVGTKLDLRDDK +LADH     IT+ QGEELRK IGA  YIECSSKTQQNVKAVFD AIKVVLQPP+  +  +RR
Sbjct:   23 LICYTSNKFPTDYIPTVFDNFSANVAVDGQIVNLGLWDTAGQEDYSRLRPLSYRGADIFVLAFSLISKASYENVLKKWMPELRRFAPNVPIVLVGTKLDLRDDKGYLADHTNV--ITSTQGEELRKQIGAAAYIECSSKTQQNVKAVFDTAIKVVLQPPRRKEVPRRR 188          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC1_RAT (Ras-related C3 botulinum toxin substrate 1 OS=Rattus norvegicus GN=Rac1 PE=1 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 1.214e-58
Identity = 104/169 (61.54%), Postives = 126/169 (74.56%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL--ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKR 605
            +ISYT+N FP +Y+PTVFDN+SANV+VDG  VNLGLWDTAGQEDY+RLRPLSY   DVFL+ FSL+S AS+ENV  KW PE+RH+ P  PIILVGTKLDLRDDK  +         PIT  QG  + K IGA  Y+ECS+ TQ+ +K VFD AI+ VL PP   K+K++
Sbjct:   20 LISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRK 188          

HSP 2 Score: 35.039 bits (79), Expect = 1.214e-58
Identity = 14/16 (87.50%), Postives = 15/16 (93.75%), Query Frame = 2
Query:   56 IKCVTVGDGAVGKTCM 103
            IKCV VGDGAVGKTC+
Sbjct:    4 IKCVVVGDGAVGKTCL 19          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC1_MOUSE (Ras-related C3 botulinum toxin substrate 1 OS=Mus musculus GN=Rac1 PE=1 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 1.214e-58
Identity = 104/169 (61.54%), Postives = 126/169 (74.56%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL--ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKR 605
            +ISYT+N FP +Y+PTVFDN+SANV+VDG  VNLGLWDTAGQEDY+RLRPLSY   DVFL+ FSL+S AS+ENV  KW PE+RH+ P  PIILVGTKLDLRDDK  +         PIT  QG  + K IGA  Y+ECS+ TQ+ +K VFD AI+ VL PP   K+K++
Sbjct:   20 LISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRK 188          

HSP 2 Score: 35.039 bits (79), Expect = 1.214e-58
Identity = 14/16 (87.50%), Postives = 15/16 (93.75%), Query Frame = 2
Query:   56 IKCVTVGDGAVGKTCM 103
            IKCV VGDGAVGKTC+
Sbjct:    4 IKCVVVGDGAVGKTCL 19          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC1_HUMAN (Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens GN=RAC1 PE=1 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 1.214e-58
Identity = 104/169 (61.54%), Postives = 126/169 (74.56%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL--ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKR 605
            +ISYT+N FP +Y+PTVFDN+SANV+VDG  VNLGLWDTAGQEDY+RLRPLSY   DVFL+ FSL+S AS+ENV  KW PE+RH+ P  PIILVGTKLDLRDDK  +         PIT  QG  + K IGA  Y+ECS+ TQ+ +K VFD AI+ VL PP   K+K++
Sbjct:   20 LISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRK 188          

HSP 2 Score: 35.039 bits (79), Expect = 1.214e-58
Identity = 14/16 (87.50%), Postives = 15/16 (93.75%), Query Frame = 2
Query:   56 IKCVTVGDGAVGKTCM 103
            IKCV VGDGAVGKTC+
Sbjct:    4 IKCVVVGDGAVGKTCL 19          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC1_CANFA (Ras-related C3 botulinum toxin substrate 1 OS=Canis familiaris GN=RAC1 PE=2 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 1.214e-58
Identity = 104/169 (61.54%), Postives = 126/169 (74.56%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL--ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKR 605
            +ISYT+N FP +Y+PTVFDN+SANV+VDG  VNLGLWDTAGQEDY+RLRPLSY   DVFL+ FSL+S AS+ENV  KW PE+RH+ P  PIILVGTKLDLRDDK  +         PIT  QG  + K IGA  Y+ECS+ TQ+ +K VFD AI+ VL PP   K+K++
Sbjct:   20 LISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRK 188          

HSP 2 Score: 35.039 bits (79), Expect = 1.214e-58
Identity = 14/16 (87.50%), Postives = 15/16 (93.75%), Query Frame = 2
Query:   56 IKCVTVGDGAVGKTCM 103
            IKCV VGDGAVGKTC+
Sbjct:    4 IKCVVVGDGAVGKTCL 19          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC1_BOVIN (Ras-related C3 botulinum toxin substrate 1 OS=Bos taurus GN=RAC1 PE=1 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 1.214e-58
Identity = 104/169 (61.54%), Postives = 126/169 (74.56%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL--ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKR 605
            +ISYT+N FP +Y+PTVFDN+SANV+VDG  VNLGLWDTAGQEDY+RLRPLSY   DVFL+ FSL+S AS+ENV  KW PE+RH+ P  PIILVGTKLDLRDDK  +         PIT  QG  + K IGA  Y+ECS+ TQ+ +K VFD AI+ VL PP   K+K++
Sbjct:   20 LISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRK 188          

HSP 2 Score: 35.039 bits (79), Expect = 1.214e-58
Identity = 14/16 (87.50%), Postives = 15/16 (93.75%), Query Frame = 2
Query:   56 IKCVTVGDGAVGKTCM 103
            IKCV VGDGAVGKTC+
Sbjct:    4 IKCVVVGDGAVGKTCL 19          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC3_MOUSE (Ras-related C3 botulinum toxin substrate 3 OS=Mus musculus GN=Rac3 PE=1 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 1.438e-56
Identity = 104/170 (61.18%), Postives = 127/170 (74.71%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDK---QFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKR 605
            +ISYT+N FP +Y+PTVFDN+SANV+VDG  VNLGLWDTAGQEDY+RLRPLSY   DVFL+ FSL+S AS+ENV  KW PE+RH+ P  PI+LVGTKLDLRDDK   + L D   A PIT  QG  + + IG+  Y+ECS+ TQ+ +K VFD AI+ VL PP   K  K+
Sbjct:   20 LISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLA-PITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKK 188          

HSP 2 Score: 35.039 bits (79), Expect = 1.438e-56
Identity = 14/16 (87.50%), Postives = 15/16 (93.75%), Query Frame = 2
Query:   56 IKCVTVGDGAVGKTCM 103
            IKCV VGDGAVGKTC+
Sbjct:    4 IKCVVVGDGAVGKTCL 19          
The following BLAST results are available for this feature:
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RAC8_ARATH1.668e-7579.17Rac-like GTP-binding protein ARAC8 OS=Arabidopsis ... [more]
RAC2_ORYSJ5.934e-7377.01Rac-like GTP-binding protein 2 OS=Oryza sativa sub... [more]
RAC9_ARATH1.322e-7277.98Rac-like GTP-binding protein ARAC9 OS=Arabidopsis ... [more]
RAC7_ARATH1.462e-7178.57Rac-like GTP-binding protein ARAC7 OS=Arabidopsis ... [more]
RAC1_RAT1.214e-5861.54Ras-related C3 botulinum toxin substrate 1 OS=Ratt... [more]
RAC1_MOUSE1.214e-5861.54Ras-related C3 botulinum toxin substrate 1 OS=Mus ... [more]
RAC1_HUMAN1.214e-5861.54Ras-related C3 botulinum toxin substrate 1 OS=Homo... [more]
RAC1_CANFA1.214e-5861.54Ras-related C3 botulinum toxin substrate 1 OS=Cani... [more]
RAC1_BOVIN1.214e-5861.54Ras-related C3 botulinum toxin substrate 1 OS=Bos ... [more]
RAC3_MOUSE1.438e-5661.18Ras-related C3 botulinum toxin substrate 3 OS=Mus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00277 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00277 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623186 ID=BQ623186|Name=BQ623186|organism=Citrus sinensis|type=EST|length=610bp
GTAATAAAGATACTGTCTTAAGTGCACGTGGCGCGAGATGAGTGCATCGA
GGTTCATAAAGTGCGTGACGGTCGGTGACGGCGCCGTCGGCAAGACTTGC
ATGCGTCATTTCTTACACCAGCAACACTTTCCCGACGGATTATGTGCCAA
CAGTATTTGACAATTTCAGTGCAAATGTGGTAGTGGATGGAAGCACTGTT
AATCTTGGGTTGTGGGACACTGCAGGCCAGGAAGATTACAATAGACTAAG
ACCATTGAGCTACCGCGGGGCAGATGTCTTCTTACTCGCATTCTCTCTCA
TTAGCAAGGCCAGCTATGAAAATGTTGCTAAGAAATGGATTCCTGAGTTG
AGGCATTATGCACCTGGTGTTCCAATAATTCTTGTCGGGACGAAGCTCGA
TCTTCGGGATGATAAGCAGTTCCTTGCAGATCACCCTGGTGCAGTGCCAA
TTACCACGGCCCAAGGGGAGGAATTGAGAAAGTTGATAGGTGCTCCTGTT
TACATTGAGTGTAGTTCCAAAACACAACAGAATGTGAAAGCTGTCTTTGA
TGCGGCCATCAAGGTGGTTCTCCAGCCGCCAAAGAACACGAAGAAAAAGA
AGAGAAGGCC
back to top