BQ623186

Overview
NameBQ623186
Unique NameBQ623186
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length610
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12 contig Csv1_Contig12:1..610. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC1_CAEEL (Ras-related protein ced-10 OS=Caenorhabditis elegans GN=ced-10 PE=1 SV=2)

HSP 1 Score: 194.897 bits (494), Expect = 1.089e-53
Identity = 95/168 (56.55%), Postives = 121/168 (72.02%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL--ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            +ISYT+N FP +Y+PTVFDN+SANV+VDG  +NLGLWDTAGQEDY+RLRPLSY   DVFL+ F+L + AS+ENV  KW PE+ H+ P  PIILVGTK DLR+D+  +         P++  QG  + K I A  Y+ECS+ TQ+ +K VFD AI+ VL PP+  KK K
Sbjct:   20 LISYTTNAFPGEYIPTVFDNYSANVMVDGRPINLGLWDTAGQEDYDRLRPLSYPQTDVFLVCFALNNPASFENVRAKWYPEVSHHCPNTPIILVGTKADLREDRDTVERLRERRLQPVSQTQGYVMAKEIKAVKYLECSALTQRGLKQVFDEAIRAVLTPPQRAKKSK 187          

HSP 2 Score: 35.039 bits (79), Expect = 1.089e-53
Identity = 14/16 (87.50%), Postives = 15/16 (93.75%), Query Frame = 2
Query:   56 IKCVTVGDGAVGKTCM 103
            IKCV VGDGAVGKTC+
Sbjct:    4 IKCVVVGDGAVGKTCL 19          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RACA_ENTHI (Rho-related protein racA OS=Entamoeba histolytica GN=RACA PE=3 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 6.384e-51
Identity = 95/169 (56.21%), Postives = 124/169 (73.37%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL--ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKR 605
            +ISYT+N FP +Y+PTVFDN+SA V+VD   +NLGLWDTAGQEDY+RLRPLSY   DVFL+ FS++S  S++NV+ KW PE+ H+ P  P +LVGTKLD+R+DK+ L   +     PITT QGE   K IGA  YIECS+ TQ+N++ VFD A++ V+ P    KK K+
Sbjct:   20 LISYTTNAFPNEYIPTVFDNYSATVMVDSKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSVVSPPSFDNVSSKWQPEVSHHCPKTPCLLVGTKLDMREDKEQLKRLEEKKITPITTEQGEAKCKDIGAVKYIECSALTQKNLRLVFDEAVRAVISPAGGAKKDKK 188          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RACB_DICDI (Rho-related protein racB OS=Dictyostelium discoideum GN=racB PE=1 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 5.405e-50
Identity = 98/169 (57.99%), Postives = 124/169 (73.37%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKR 605
            +ISYTSN+FPT+YVPTVFDN+SANV+VD  TV+LGLWDTAGQEDY+RLRPLSY   DVFL+ F++IS+ SY NV  KW PE+ H+ P   IILVGTK DLR+DK+ L         P+T  QGE++ K I A  Y+ECS+ TQ+ +K VFD AIK V+ P ++    K+
Sbjct:   20 LISYTSNSFPTEYVPTVFDNYSANVMVDNKTVSLGLWDTAGQEDYDRLRPLSYPQTDVFLICFAIISQTSYTNVKSKWWPEVTHHCPNCTIILVGTKCDLREDKESLEKLREKHQQPLTFQQGEQMAKEIKAFCYMECSALTQKGLKQVFDEAIKAVIFPDRDKATNKK 188          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RECG_ENTHI (Rho-related protein racG OS=Entamoeba histolytica GN=RACG PE=3 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 3.873e-48
Identity = 95/171 (55.56%), Postives = 124/171 (72.51%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL--ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVL----QPPKNTKKK 599
            +ISYT+N FP +Y+PTVF+N+++++VVD   +NLGLWDTAGQEDY+RLRPLSY   DVFL+ FS+I+ ASYENV  KW PE+  + P VPIILVGTK+D+RDD + +        VPI   QG+EL K IGA  YIECS+ TQ N+K VF+ A++ VL    + P   K+K
Sbjct:   20 LISYTTNAFPNEYIPTVFENYNSSLVVDDVKINLGLWDTAGQEDYDRLRPLSYPSTDVFLVCFSVIAPASYENVEGKWKPEIDQHCPNVPIILVGTKIDIRDDPEQVKRLAEKNIVPIQPPQGDELAKKIGAVKYIECSALTQANLKLVFEEAVRAVLAKAAKEPTGKKEK 190          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOG_MOUSE (Rho-related GTP-binding protein RhoG OS=Mus musculus GN=Rhog PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 3.040e-47
Identity = 88/160 (55.00%), Postives = 107/160 (66.88%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL--ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQP 578
            +I YT+N FP +Y+PTVFDN+SA   VDG TVNL LWDTAGQE+Y+RLR LSY   +VF++ FS+ S  SYENV  KW PE+ H+ P VPI+LVGTK DLR     L      G  PIT  QG+ L K I A  Y+ECS+  Q  VK VF  A++ VL P
Sbjct:   20 LICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAGQEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNP 179          

HSP 2 Score: 35.039 bits (79), Expect = 3.040e-47
Identity = 14/16 (87.50%), Postives = 15/16 (93.75%), Query Frame = 2
Query:   56 IKCVTVGDGAVGKTCM 103
            IKCV VGDGAVGKTC+
Sbjct:    4 IKCVVVGDGAVGKTCL 19          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOG_HUMAN (Rho-related GTP-binding protein RhoG OS=Homo sapiens GN=RHOG PE=1 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 3.040e-47
Identity = 88/160 (55.00%), Postives = 107/160 (66.88%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL--ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQP 578
            +I YT+N FP +Y+PTVFDN+SA   VDG TVNL LWDTAGQE+Y+RLR LSY   +VF++ FS+ S  SYENV  KW PE+ H+ P VPI+LVGTK DLR     L      G  PIT  QG+ L K I A  Y+ECS+  Q  VK VF  A++ VL P
Sbjct:   20 LICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAGQEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNP 179          

HSP 2 Score: 35.039 bits (79), Expect = 3.040e-47
Identity = 14/16 (87.50%), Postives = 15/16 (93.75%), Query Frame = 2
Query:   56 IKCVTVGDGAVGKTCM 103
            IKCV VGDGAVGKTC+
Sbjct:    4 IKCVVVGDGAVGKTCL 19          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOG_CRICR (Rho-related GTP-binding protein RhoG OS=Cricetus cricetus GN=RHOG PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 3.040e-47
Identity = 88/160 (55.00%), Postives = 107/160 (66.88%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL--ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQP 578
            +I YT+N FP +Y+PTVFDN+SA   VDG TVNL LWDTAGQE+Y+RLR LSY   +VF++ FS+ S  SYENV  KW PE+ H+ P VPI+LVGTK DLR     L      G  PIT  QG+ L K I A  Y+ECS+  Q  VK VF  A++ VL P
Sbjct:   20 LICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAGQEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNP 179          

HSP 2 Score: 35.039 bits (79), Expect = 3.040e-47
Identity = 14/16 (87.50%), Postives = 15/16 (93.75%), Query Frame = 2
Query:   56 IKCVTVGDGAVGKTCM 103
            IKCV VGDGAVGKTC+
Sbjct:    4 IKCVVVGDGAVGKTCL 19          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: CDC42_CANAL (Cell division control protein 42 homolog OS=Candida albicans GN=CDC42 PE=3 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 7.305e-47
Identity = 93/168 (55.36%), Postives = 118/168 (70.24%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL--ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            +ISYT++ FP DYVPTVFDN++  V++      LGL+DTAGQEDY+RLRPLSY   DVFL+ FS+IS AS+ENV +KW PE+ H+ PGVPII+VGT+ DLR+D   L         PIT  QGE+L K + A  Y+ECS+ TQ+ +K VFD AI   L+PP   K KK
Sbjct:   20 LISYTTSKFPADYVPTVFDNYAVTVMIGDEPFTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPASFENVKEKWFPEVHHHCPGVPIIIVGTQTDLRNDDVILQRLHRQKLSPITQEQGEKLAKELRAVKYVECSALTQRGLKTVFDEAIVAALEPPVIKKSKK 187          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: CDC42_SCHPO (Cell division control protein 42 homolog OS=Schizosaccharomyces pombe GN=cdc42 PE=1 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 1.627e-46
Identity = 93/170 (54.71%), Postives = 121/170 (71.18%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDD---KQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKR 605
            +ISYT+N FP+DYVPTVFDN++  V++      LGL+DTAGQEDY+RLRPLSY   DVFL+ FS+ S AS+ENV +KW PE+ H+ PGVP ++VGT++DLRDD   +Q LA      P+T  QGE L + +GA  Y+ECS+ TQ+ +K VFD AI   L PP   KKK +
Sbjct:   20 LISYTTNKFPSDYVPTVFDNYAVTVMIGDEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVTSPASFENVKEKWFPEVHHHCPGVPCLIVGTQIDLRDDPSVQQKLA-RQHQHPLTHEQGERLARELGAVKYVECSALTQKGLKNVFDEAIVAALDPPVPHKKKSK 188          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: CDC42_ANOGA (Cdc42 homolog OS=Anopheles gambiae GN=Cdc42 PE=2 SV=2)

HSP 1 Score: 185.652 bits (470), Expect = 1.627e-46
Identity = 90/170 (52.94%), Postives = 122/170 (71.76%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKRR 608
            +ISYT+N FP++YVPTVFDN++  V++ G    LGL+DTAGQEDY+RLRPLSY   DVFL+ FS++S +S+ENV +KW+PE+ H+    P +LVGT++DLRD+   L         PIT  QGE+L K + A  Y+ECS+ TQ+ +K VFD AI   L+PP+ TKK+K R
Sbjct:   20 LISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDENSTLEKLAKNKQKPITLEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPPEPTKKRKCR 189          
The following BLAST results are available for this feature:
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RAC1_CAEEL1.089e-5356.55Ras-related protein ced-10 OS=Caenorhabditis elega... [more]
RACA_ENTHI6.384e-5156.21Rho-related protein racA OS=Entamoeba histolytica ... [more]
RACB_DICDI5.405e-5057.99Rho-related protein racB OS=Dictyostelium discoide... [more]
RECG_ENTHI3.873e-4855.56Rho-related protein racG OS=Entamoeba histolytica ... [more]
RHOG_MOUSE3.040e-4755.00Rho-related GTP-binding protein RhoG OS=Mus muscul... [more]
RHOG_HUMAN3.040e-4755.00Rho-related GTP-binding protein RhoG OS=Homo sapie... [more]
RHOG_CRICR3.040e-4755.00Rho-related GTP-binding protein RhoG OS=Cricetus c... [more]
CDC42_CANAL7.305e-4755.36Cell division control protein 42 homolog OS=Candid... [more]
CDC42_SCHPO1.627e-4654.71Cell division control protein 42 homolog OS=Schizo... [more]
CDC42_ANOGA1.627e-4652.94Cdc42 homolog OS=Anopheles gambiae GN=Cdc42 PE=2 S... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00277 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00277 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623186 ID=BQ623186|Name=BQ623186|organism=Citrus sinensis|type=EST|length=610bp
GTAATAAAGATACTGTCTTAAGTGCACGTGGCGCGAGATGAGTGCATCGA
GGTTCATAAAGTGCGTGACGGTCGGTGACGGCGCCGTCGGCAAGACTTGC
ATGCGTCATTTCTTACACCAGCAACACTTTCCCGACGGATTATGTGCCAA
CAGTATTTGACAATTTCAGTGCAAATGTGGTAGTGGATGGAAGCACTGTT
AATCTTGGGTTGTGGGACACTGCAGGCCAGGAAGATTACAATAGACTAAG
ACCATTGAGCTACCGCGGGGCAGATGTCTTCTTACTCGCATTCTCTCTCA
TTAGCAAGGCCAGCTATGAAAATGTTGCTAAGAAATGGATTCCTGAGTTG
AGGCATTATGCACCTGGTGTTCCAATAATTCTTGTCGGGACGAAGCTCGA
TCTTCGGGATGATAAGCAGTTCCTTGCAGATCACCCTGGTGCAGTGCCAA
TTACCACGGCCCAAGGGGAGGAATTGAGAAAGTTGATAGGTGCTCCTGTT
TACATTGAGTGTAGTTCCAAAACACAACAGAATGTGAAAGCTGTCTTTGA
TGCGGCCATCAAGGTGGTTCTCCAGCCGCCAAAGAACACGAAGAAAAAGA
AGAGAAGGCC
back to top