BQ623186

Overview
NameBQ623186
Unique NameBQ623186
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length610
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12 contig Csv1_Contig12:1..610. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAB4B_MOUSE (Ras-related protein Rab-4B OS=Mus musculus GN=Rab4b PE=2 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 6.459e-11
Identity = 50/161 (31.06%), Postives = 80/161 (49.69%), Query Frame = 3
Query:   99 ACVI-SYTSNTFPTDYVPTVFDNFSANVV-VDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYA-PGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVL 572
            +C++  +  N F  D   T+   F + VV V G TV L +WDTAGQE +  +    YRGA   LL + + S+ +Y ++A  W+ + R  A P + +IL G K DL  +++             AQ  EL       +++E S+ T +NV+  F    + +L
Sbjct:   22 SCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNSLA-AWLTDARTLASPNIVVILCGNKKDLDPEREVTFLEASRF----AQENEL-------MFLETSALTGENVEEAFLKCARTIL 170          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAB4B_HUMAN (Ras-related protein Rab-4B OS=Homo sapiens GN=RAB4B PE=1 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.459e-11
Identity = 50/161 (31.06%), Postives = 80/161 (49.69%), Query Frame = 3
Query:   99 ACVI-SYTSNTFPTDYVPTVFDNFSANVV-VDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYA-PGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVL 572
            +C++  +  N F  D   T+   F + VV V G TV L +WDTAGQE +  +    YRGA   LL + + S+ +Y ++A  W+ + R  A P + +IL G K DL  +++             AQ  EL       +++E S+ T +NV+  F    + +L
Sbjct:   22 SCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNSLA-AWLTDARTLASPNIVVILCGNKKDLDPEREVTFLEASRF----AQENEL-------MFLETSALTGENVEEAFLKCARTIL 170          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAB4B_DANRE (Ras-related protein Rab-4B OS=Danio rerio GN=rab4b PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.459e-11
Identity = 51/153 (33.33%), Postives = 75/153 (49.02%), Query Frame = 3
Query:   99 ACVI-SYTSNTFPTDYVPTVFDNFSANVV-VDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYA-PGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVF 548
            +C++  +  N F  D   T+   F + VV V G TV L +WDTAGQE +  +    YRGA   LL + + S+ +Y N    W+ + R  A P + IIL G K DL  D++             AQ  EL       +++E S+ T +NV+  F
Sbjct:   22 SCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETY-NALTNWLTDARTLASPNIVIILCGNKKDLDADREVTFLEASRF----AQENEL-------MFLETSALTGENVEEAF 162          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAB4B_CANFA (Ras-related protein Rab-4B OS=Canis familiaris GN=RAB4B PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.459e-11
Identity = 50/161 (31.06%), Postives = 80/161 (49.69%), Query Frame = 3
Query:   99 ACVI-SYTSNTFPTDYVPTVFDNFSANVV-VDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYA-PGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVL 572
            +C++  +  N F  D   T+   F + VV V G TV L +WDTAGQE +  +    YRGA   LL + + S+ +Y ++A  W+ + R  A P + +IL G K DL  +++             AQ  EL       +++E S+ T +NV+  F    + +L
Sbjct:   22 SCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNSLA-AWLTDARTLASPNIVVILCGNKKDLDPEREVTFLEASRF----AQENEL-------MFLETSALTGENVEEAFLKCARTIL 170          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAB3B_HUMAN (Ras-related protein Rab-3B OS=Homo sapiens GN=RAB3B PE=1 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 6.459e-11
Identity = 43/154 (27.92%), Postives = 76/154 (49.35%), Query Frame = 3
Query:  114 YTSNTFPTDYVPTVFDNFSANVVV-DGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYA-PGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVV 569
            Y  +TF   +V TV  +F    V      V L +WDTAGQE Y  +    YRGA  F+L + + ++ S+ N  + W  +++ Y+     +ILVG K D+ +++           + T +G+ L + +G   + E S+K   +V+  F+  +  +
Sbjct:   42 YADDTFTPAFVSTVGIDFKVKTVYRHEKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESF-NAVQDWATQIKTYSWDNAQVILVGNKCDMEEER----------VVPTEKGQLLAEQLGFD-FFEASAKENISVRQAFERLVDAI 183          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAB3B_BOVIN (Ras-related protein Rab-3B OS=Bos taurus GN=RAB3B PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.459e-11
Identity = 44/161 (27.33%), Postives = 77/161 (47.83%), Query Frame = 3
Query:  114 YTSNTFPTDYVPTVFDNFSANVVV-DGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYA-PGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNT 590
            Y  +TF   +V TV  +F    V      V L +WDTAGQE Y  +    YRGA  F+L + + ++ S+ N  + W  +++ Y+     +ILVG K D+ +++           + T +G  L + +G   + E S+K   +V+  F+  +  +     +T
Sbjct:   42 YADDTFTPAFVSTVGIDFKVKTVYRHEKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESF-NAVQDWATQIKTYSWDNAQVILVGNKCDMEEER----------VVPTEKGRLLAEQLGFD-FFEASAKENISVRQAFERLVDAICDKMSDT 190          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAB14_RAT (Ras-related protein Rab-14 OS=Rattus norvegicus GN=Rab14 PE=2 SV=3)

HSP 1 Score: 67.3958 bits (163), Expect = 6.459e-11
Identity = 44/162 (27.16%), Postives = 81/162 (50.00%), Query Frame = 3
Query:   99 ACVI-SYTSNTFPTDYVPTVFDNFSANVV-VDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYA-PGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQ 575
            +C++  +T   F  D   T+   F   ++ V G  + L +WDTAGQE +  +    YRGA   L+ + +  +++Y +++  W+ + R+   P   IIL+G K DL   +           +T  + ++  +  G  +++E S+KT +NV+  F  A K + Q
Sbjct:   25 SCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLS-SWLTDARNLTNPNTVIILIGNKADLEAQRD----------VTYEEAKQFAEENGL-LFLEASAKTGENVEDAFLEAAKKIYQ 174          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAB14_PONAB (Ras-related protein Rab-14 OS=Pongo abelii GN=RAB14 PE=2 SV=3)

HSP 1 Score: 67.3958 bits (163), Expect = 6.459e-11
Identity = 44/162 (27.16%), Postives = 81/162 (50.00%), Query Frame = 3
Query:   99 ACVI-SYTSNTFPTDYVPTVFDNFSANVV-VDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYA-PGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQ 575
            +C++  +T   F  D   T+   F   ++ V G  + L +WDTAGQE +  +    YRGA   L+ + +  +++Y +++  W+ + R+   P   IIL+G K DL   +           +T  + ++  +  G  +++E S+KT +NV+  F  A K + Q
Sbjct:   25 SCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLS-SWLTDARNLTNPNTVIILIGNKADLEAQRD----------VTYEEAKQFAEENGL-LFLEASAKTGENVEDAFLEAAKKIYQ 174          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAB14_PIG (Ras-related protein Rab-14 OS=Sus scrofa GN=RAB14 PE=2 SV=3)

HSP 1 Score: 67.3958 bits (163), Expect = 6.459e-11
Identity = 44/162 (27.16%), Postives = 81/162 (50.00%), Query Frame = 3
Query:   99 ACVI-SYTSNTFPTDYVPTVFDNFSANVV-VDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYA-PGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQ 575
            +C++  +T   F  D   T+   F   ++ V G  + L +WDTAGQE +  +    YRGA   L+ + +  +++Y +++  W+ + R+   P   IIL+G K DL   +           +T  + ++  +  G  +++E S+KT +NV+  F  A K + Q
Sbjct:   25 SCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLS-SWLTDARNLTNPNTVIILIGNKADLEAQRD----------VTYEEAKQFAEENGL-LFLEASAKTGENVEDAFLEAAKKIYQ 174          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAB14_MOUSE (Ras-related protein Rab-14 OS=Mus musculus GN=Rab14 PE=1 SV=3)

HSP 1 Score: 67.3958 bits (163), Expect = 6.459e-11
Identity = 44/162 (27.16%), Postives = 81/162 (50.00%), Query Frame = 3
Query:   99 ACVI-SYTSNTFPTDYVPTVFDNFSANVV-VDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYA-PGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQ 575
            +C++  +T   F  D   T+   F   ++ V G  + L +WDTAGQE +  +    YRGA   L+ + +  +++Y +++  W+ + R+   P   IIL+G K DL   +           +T  + ++  +  G  +++E S+KT +NV+  F  A K + Q
Sbjct:   25 SCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLS-SWLTDARNLTNPNTVIILIGNKADLEAQRD----------VTYEEAKQFAEENGL-LFLEASAKTGENVEDAFLEAAKKIYQ 174          
The following BLAST results are available for this feature:
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RAB4B_MOUSE6.459e-1131.06Ras-related protein Rab-4B OS=Mus musculus GN=Rab4... [more]
RAB4B_HUMAN6.459e-1131.06Ras-related protein Rab-4B OS=Homo sapiens GN=RAB4... [more]
RAB4B_DANRE6.459e-1133.33Ras-related protein Rab-4B OS=Danio rerio GN=rab4b... [more]
RAB4B_CANFA6.459e-1131.06Ras-related protein Rab-4B OS=Canis familiaris GN=... [more]
RAB3B_HUMAN6.459e-1127.92Ras-related protein Rab-3B OS=Homo sapiens GN=RAB3... [more]
RAB3B_BOVIN6.459e-1127.33Ras-related protein Rab-3B OS=Bos taurus GN=RAB3B ... [more]
RAB14_RAT6.459e-1127.16Ras-related protein Rab-14 OS=Rattus norvegicus GN... [more]
RAB14_PONAB6.459e-1127.16Ras-related protein Rab-14 OS=Pongo abelii GN=RAB1... [more]
RAB14_PIG6.459e-1127.16Ras-related protein Rab-14 OS=Sus scrofa GN=RAB14 ... [more]
RAB14_MOUSE6.459e-1127.16Ras-related protein Rab-14 OS=Mus musculus GN=Rab1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00277 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00277 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623186 ID=BQ623186|Name=BQ623186|organism=Citrus sinensis|type=EST|length=610bp
GTAATAAAGATACTGTCTTAAGTGCACGTGGCGCGAGATGAGTGCATCGA
GGTTCATAAAGTGCGTGACGGTCGGTGACGGCGCCGTCGGCAAGACTTGC
ATGCGTCATTTCTTACACCAGCAACACTTTCCCGACGGATTATGTGCCAA
CAGTATTTGACAATTTCAGTGCAAATGTGGTAGTGGATGGAAGCACTGTT
AATCTTGGGTTGTGGGACACTGCAGGCCAGGAAGATTACAATAGACTAAG
ACCATTGAGCTACCGCGGGGCAGATGTCTTCTTACTCGCATTCTCTCTCA
TTAGCAAGGCCAGCTATGAAAATGTTGCTAAGAAATGGATTCCTGAGTTG
AGGCATTATGCACCTGGTGTTCCAATAATTCTTGTCGGGACGAAGCTCGA
TCTTCGGGATGATAAGCAGTTCCTTGCAGATCACCCTGGTGCAGTGCCAA
TTACCACGGCCCAAGGGGAGGAATTGAGAAAGTTGATAGGTGCTCCTGTT
TACATTGAGTGTAGTTCCAAAACACAACAGAATGTGAAAGCTGTCTTTGA
TGCGGCCATCAAGGTGGTTCTCCAGCCGCCAAAGAACACGAAGAAAAAGA
AGAGAAGGCC
back to top