BQ623186

Overview
NameBQ623186
Unique NameBQ623186
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length610
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12 contig Csv1_Contig12:1..610. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: CDC42_AEDAE (Cdc42 homolog OS=Aedes aegypti GN=Cdc42 PE=3 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 2.125e-46
Identity = 89/168 (52.98%), Postives = 122/168 (72.62%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            +ISYT+N FP++YVPTVFDN++  V++ G    LGL+DTAGQEDY+RLRPLSY   DVFL+ FS++S +S+ENV +KW+PE+ H+    P +LVGT++DLRD++  L         PIT  QGE+L K + A  Y+ECS+ TQ+ +K VFD AI   L+PP+ TKK+K
Sbjct:   20 LISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDEQSTLEKLAKNKQKPITLEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPPEPTKKRK 187          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RACA_DICDI (Rho-related protein racA OS=Dictyostelium discoideum GN=racA PE=1 SV=2)

HSP 1 Score: 175.637 bits (444), Expect = 2.498e-46
Identity = 83/166 (50.00%), Postives = 113/166 (68.07%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            +I+YT+N FP +YVPTVFDN+SANV++DG   NLGLWDTAGQEDY+RLRPLSY   DVFL+ FS++S+AS+EN+  KW PE+ H+AP +PI+LVGTK DLR              ++ A+   L + +G   Y+E S+  Q N++ +F  AI+    P   + KKK
Sbjct:   20 LIAYTTNAFPGEYVPTVFDNYSANVMIDGKPFNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSIVSRASFENIRAKWYPEILHHAPNIPIVLVGTKNDLRGHHDLKRPE-----VSAAEANNLVRELGFSGYVETSALLQTNLRELFSLAIRTATSPKSASAKKK 180          

HSP 2 Score: 29.6462 bits (65), Expect = 2.498e-46
Identity = 12/16 (75.00%), Postives = 14/16 (87.50%), Query Frame = 2
Query:   56 IKCVTVGDGAVGKTCM 103
            IK V VGDGAVGK+C+
Sbjct:    4 IKLVVVGDGAVGKSCL 19          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: CDC42_YEAST (Cell division control protein 42 OS=Saccharomyces cerevisiae GN=CDC42 PE=1 SV=2)

HSP 1 Score: 184.882 bits (468), Expect = 2.776e-46
Identity = 90/168 (53.57%), Postives = 117/168 (69.64%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL--ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            +ISYT+N FP DYVPTVFDN++  V++      LGL+DTAGQEDY+RLRPLSY   DVFL+ FS+IS  S+ENV +KW PE+ H+ PGVP ++VGT++DLRDDK  +         PIT+ QG  L + + A  Y+ECS+ TQ+ +K VFD AI   L+PP   K KK
Sbjct:   20 LISYTTNQFPADYVPTVFDNYAVTVMIGDEPYTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLVVGTQIDLRDDKVIIEKLQRQRLRPITSEQGSRLARELKAVKYVECSALTQRGLKNVFDEAIVAALEPPVIKKSKK 187          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: CDC42_DROME (Cdc42 homolog OS=Drosophila melanogaster GN=Cdc42 PE=1 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 2.776e-46
Identity = 89/168 (52.98%), Postives = 121/168 (72.02%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            +ISYT+N FP++YVPTVFDN++  V++ G    LGL+DTAGQEDY+RLRPLSY   DVFL+ FS++S +S+ENV +KW+PE+ H+    P +LVGT++DLRD+   L         PIT  QGE+L K + A  Y+ECS+ TQ+ +K VFD AI   L+PP+ TKK+K
Sbjct:   20 LISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDENSTLEKLAKNKQKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPPEPTKKRK 187          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: CDC42_DROPS (Cdc42 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Cdc42 PE=3 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 3.625e-46
Identity = 89/168 (52.98%), Postives = 121/168 (72.02%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            +ISYT+N FP++YVPTVFDN++  V++ G    LGL+DTAGQEDY+RLRPLSY   DVFL+ FS++S +S+ENV +KW+PE+ H+    P +LVGT++DLRD+   L         PIT  QGE+L K + A  Y+ECS+ TQ+ +K VFD AI   L+PP+ TKK+K
Sbjct:   20 LISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDETSTLEKLAKNKQKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPPEPTKKRK 187          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOQ_HUMAN (Rho-related GTP-binding protein RhoQ OS=Homo sapiens GN=RHOQ PE=1 SV=2)

HSP 1 Score: 184.111 bits (466), Expect = 4.735e-46
Identity = 88/168 (52.38%), Postives = 124/168 (73.81%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLA--DHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            ++SY ++ FP +YVPTVFD+++ +V V G    LGL+DTAGQEDY+RLRPLSY   DVFL+ FS+++ AS++NV ++W+PEL+ YAP VP +L+GT++DLRDD + LA  +     PI   QG++L K IGA  Y+ECS+ TQ+ +K VFD AI  +L P K+T KK+
Sbjct:   26 LMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLGLYDTAGQEDYDRLRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTPKKHTVKKR 193          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOQ_RAT (Rho-related GTP-binding protein RhoQ OS=Rattus norvegicus GN=Rhoq PE=2 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 6.184e-46
Identity = 87/168 (51.79%), Postives = 124/168 (73.81%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLA--DHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            ++SY ++ FP +YVPTVFD+++ +V V G    LGL+DTAGQEDY+RLRPLSY   DVFL+ FS+++ AS++NV ++W+PEL+ YAP VP +L+GT++DLRDD + LA  +     P+   QG++L K IGA  Y+ECS+ TQ+ +K VFD AI  +L P K+T KK+
Sbjct:   26 LMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLGLYDTAGQEDYDRLRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPVCVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTPKKHTVKKR 193          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOQ_MOUSE (Rho-related GTP-binding protein RhoQ OS=Mus musculus GN=Rhoq PE=1 SV=2)

HSP 1 Score: 183.726 bits (465), Expect = 6.184e-46
Identity = 87/168 (51.79%), Postives = 124/168 (73.81%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLA--DHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            ++SY ++ FP +YVPTVFD+++ +V V G    LGL+DTAGQEDY+RLRPLSY   DVFL+ FS+++ AS++NV ++W+PEL+ YAP VP +L+GT++DLRDD + LA  +     P+   QG++L K IGA  Y+ECS+ TQ+ +K VFD AI  +L P K+T KK+
Sbjct:   26 LMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLGLYDTAGQEDYDRLRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPVCVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTPKKHTVKKR 193          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RACC_DICDI (Rho-related protein racC OS=Dictyostelium discoideum GN=racC PE=1 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.378e-45
Identity = 91/166 (54.82%), Postives = 113/166 (68.07%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL--ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKK 596
            +ISY +N FP DY+PTVFDN+  N+      + LGLWDTAGQE+Y++LRPLSY  A+VFL+ FS+ +  S+ENV  KW PE+ H+ P VP ILVGTKLD RDD+  L      G  PITT QG +L + I A  Y+ECS+KT QN+K VFD AIK VL   K   K
Sbjct:   23 LISYANNRFPEDYIPTVFDNYVVNLTAGDRNIELGLWDTAGQEEYDKLRPLSYANANVFLICFSITNPVSFENVYTKWYPEVMHFCPEVPQILVGTKLDTRDDRGVLDKLQQTGHKPITTEQGNDLARRIKAIKYMECSAKTSQNLKQVFDEAIKSVLFIKKKKSK 188          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: CDC42_CAEEL (Cell division control protein 42 homolog OS=Caenorhabditis elegans GN=cdc-42 PE=1 SV=2)

HSP 1 Score: 181.8 bits (460), Expect = 2.350e-45
Identity = 88/168 (52.38%), Postives = 119/168 (70.83%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            +ISYT+N FP++YVPTVFDN++  V++ G    LGL+DTAGQEDY+RLRPLSY   DVFL+ FS+++ AS+ENV +KW+PE+ H+    P +LVGT++DLRDD   L         P++T  GE+L K + A  Y+ECS+ TQ+ +K VFD AI   L PP+  KKKK
Sbjct:   20 LISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVAPASFENVREKWVPEISHHCSKTPFLLVGTQVDLRDDPGMLEKLAKNKQKPVSTDVGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALDPPQQEKKKK 187          
The following BLAST results are available for this feature:
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CDC42_AEDAE2.125e-4652.98Cdc42 homolog OS=Aedes aegypti GN=Cdc42 PE=3 SV=1[more]
RACA_DICDI2.498e-4650.00Rho-related protein racA OS=Dictyostelium discoide... [more]
CDC42_YEAST2.776e-4653.57Cell division control protein 42 OS=Saccharomyces ... [more]
CDC42_DROME2.776e-4652.98Cdc42 homolog OS=Drosophila melanogaster GN=Cdc42 ... [more]
CDC42_DROPS3.625e-4652.98Cdc42 homolog OS=Drosophila pseudoobscura pseudoob... [more]
RHOQ_HUMAN4.735e-4652.38Rho-related GTP-binding protein RhoQ OS=Homo sapie... [more]
RHOQ_RAT6.184e-4651.79Rho-related GTP-binding protein RhoQ OS=Rattus nor... [more]
RHOQ_MOUSE6.184e-4651.79Rho-related GTP-binding protein RhoQ OS=Mus muscul... [more]
RACC_DICDI1.378e-4554.82Rho-related protein racC OS=Dictyostelium discoide... [more]
CDC42_CAEEL2.350e-4552.38Cell division control protein 42 homolog OS=Caenor... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00277 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00277 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623186 ID=BQ623186|Name=BQ623186|organism=Citrus sinensis|type=EST|length=610bp
GTAATAAAGATACTGTCTTAAGTGCACGTGGCGCGAGATGAGTGCATCGA
GGTTCATAAAGTGCGTGACGGTCGGTGACGGCGCCGTCGGCAAGACTTGC
ATGCGTCATTTCTTACACCAGCAACACTTTCCCGACGGATTATGTGCCAA
CAGTATTTGACAATTTCAGTGCAAATGTGGTAGTGGATGGAAGCACTGTT
AATCTTGGGTTGTGGGACACTGCAGGCCAGGAAGATTACAATAGACTAAG
ACCATTGAGCTACCGCGGGGCAGATGTCTTCTTACTCGCATTCTCTCTCA
TTAGCAAGGCCAGCTATGAAAATGTTGCTAAGAAATGGATTCCTGAGTTG
AGGCATTATGCACCTGGTGTTCCAATAATTCTTGTCGGGACGAAGCTCGA
TCTTCGGGATGATAAGCAGTTCCTTGCAGATCACCCTGGTGCAGTGCCAA
TTACCACGGCCCAAGGGGAGGAATTGAGAAAGTTGATAGGTGCTCCTGTT
TACATTGAGTGTAGTTCCAAAACACAACAGAATGTGAAAGCTGTCTTTGA
TGCGGCCATCAAGGTGGTTCTCCAGCCGCCAAAGAACACGAAGAAAAAGA
AGAGAAGGCC
back to top