BQ623186

Overview
NameBQ623186
Unique NameBQ623186
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length610
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12 contig Csv1_Contig12:1..610. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: CDC42_ASHGO (Cell division control protein 42 OS=Ashbya gossypii GN=CDC42 PE=3 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 2.350e-45
Identity = 87/168 (51.79%), Postives = 117/168 (69.64%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL--ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            +ISYT+N FP DYVPTVFDN++  V++      LGL+DTAGQEDY+RLRPLSY   DVFL+ FS++S  S+ENV +KW PE+ H+ PGVP ++VGT++DLR++K  +         PIT  QGE+  + + A  Y+ECS+ TQ+ +K VFD AI   L+PP   K KK
Sbjct:   20 LISYTTNQFPADYVPTVFDNYAVTVMIGDEPYTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVVSPPSFENVKEKWFPEVHHHCPGVPCLIVGTQIDLRENKMVIEKLQRQRLRPITPEQGEKFARELRAVKYVECSALTQRGLKNVFDEAIVAALEPPVIKKSKK 187          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC2_CAEEL (Ras-related protein rac-2 OS=Caenorhabditis elegans GN=rac-2 PE=2 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 3.577e-45
Identity = 81/170 (47.65%), Postives = 114/170 (67.06%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL--ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKRR 608
            ++SYT+N FP +Y+ TVFD +S NV+VDG  +NL LWDTAGQ+DY++ R LS+   DVFL+ F+L + AS+ENV  KW PE+ H+ P  PIILVGTK DLR+D+  +         P++  QG  + K I A  Y+ECS+ TQ  +K VFD AI+  L PP+  + + ++
Sbjct:   20 LLSYTTNAFPGEYILTVFDTYSTNVMVDGRPINLSLWDTAGQDDYDQFRHLSFPQTDVFLVCFALNNPASFENVRAKWYPEVSHHCPNTPIILVGTKADLREDRDTIERLRERRLQPVSHTQGYVMAKEIKAVKYLECSALTQIGLKQVFDEAIRTGLTPPQTPQTRAKK 189          

HSP 2 Score: 35.039 bits (79), Expect = 3.577e-45
Identity = 14/16 (87.50%), Postives = 15/16 (93.75%), Query Frame = 2
Query:   56 IKCVTVGDGAVGKTCM 103
            IKCV VGDGAVGKTC+
Sbjct:    4 IKCVVVGDGAVGKTCL 19          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RACB_ENTHI (Rho-related protein racB (Fragment) OS=Entamoeba histolytica GN=RACB PE=3 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 4.677e-45
Identity = 86/153 (56.21%), Postives = 113/153 (73.86%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL--ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAA 557
            ++SYT+N FPT+YVPTVFDN+SA V+VD   +NLGLWDTAGQEDY+R+RPLSY   DVFLL FS++S  S+EN++ KW PE+ H+ P  P +L+GTK+D+RD++            PIT+ QGE   K IGA  YIECS+ TQ+N++ VFD A
Sbjct:   11 LVSYTTNAFPTEYVPTVFDNYSATVMVDSRPINLGLWDTAGQEDYDRIRPLSYPQTDVFLLCFSVVSPPSFENISSKWKPEVSHHCPNAPCLLIGTKIDIRDEQTQTNKTCDKKIEPITSEQGEAKCKDIGALKYIECSALTQKNLRYVFDEA 163          

HSP 2 Score: 20.4014 bits (41), Expect = 4.677e-45
Identity = 7/10 (70.00%), Postives = 8/10 (80.00%), Query Frame = 2
Query:   74 GDGAVGKTCM 103
            G G VGKTC+
Sbjct:    1 GAGGVGKTCL 10          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RACF1_DICDI (Rho-related protein racF1 OS=Dictyostelium discoideum GN=racF1 PE=1 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.166e-44
Identity = 92/172 (53.49%), Postives = 124/172 (72.09%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDD----KQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKRR 608
            +ISYT+N FP++Y+PTVFDN+ AN++++G   +LGLWDTAGQEDY+RLRPLSY   DVFL+ FS+IS+AS+ENV  KW  E+ H+APGVPIILVGTK D+R+D    K+    +   VP    +G E  K I A +Y+E S+ TQ+ +K VFD  I+ V+ P K  KK K++
Sbjct:   20 LISYTTNGFPSEYIPTVFDNYCANLMLEGKPYSLGLWDTAGQEDYDRLRPLSYPHTDVFLICFSIISQASFENVTTKWFKEVNHHAPGVPIILVGTKQDIRNDNDSIKKLKEKNIELVPY--EKGLEKAKEINA-IYLEASALTQRGIKDVFDQCIRSVIYPNKLIKKPKKK 188          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RACD_ENTHI (Rho-related protein racD (Fragment) OS=Entamoeba histolytica GN=RACD PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 2.598e-44
Identity = 87/171 (50.88%), Postives = 119/171 (69.59%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQF---LADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKRR 608
            +I YT+N FP DYVPTVFDN+ A + VDG  +NLGLWDTAGQED  +LRPLSY   D+FLL FS+IS+ S+ N++ KW+PE++HY P   +++VGT  D R+D+     LAD     PITT +GE+L K I A  Y+ECS+ T+  +  VFD AI +VL   +++KK  ++
Sbjct:   25 LICYTTNEFPKDYVPTVFDNYMAPMTVDGEPINLGLWDTAGQEDSEQLRPLSYPNTDLFLLCFSVISRTSFNNISSKWLPEIKHYEPKCKMMVVGTNTDCRNDEAMIRKLADE-NQKPITTEEGEKLAKDIKAICYMECSALTRSGLNQVFDEAIHIVLNKNQSSKKSSKK 194          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: CDC42_MOUSE (Cell division control protein 42 homolog OS=Mus musculus GN=Cdc42 PE=1 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 2.598e-44
Identity = 85/168 (50.60%), Postives = 118/168 (70.24%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            +ISYT+N FP++YVPTVFDN++  V++ G    LGL+DTAGQEDY+RLRPLSY   DVFL+ FS++S +S+ENV +KW+PE+ H+ P  P +LVGT++DLRDD   +         PIT    E+L + + A  Y+ECS+ TQ+ +K VFD AI   L+PP+   K+K
Sbjct:   20 LISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQRGLKNVFDEAILAALEPPETQPKRK 187          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: CDC42_HUMAN (Cell division control protein 42 homolog OS=Homo sapiens GN=CDC42 PE=1 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 2.598e-44
Identity = 85/168 (50.60%), Postives = 118/168 (70.24%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            +ISYT+N FP++YVPTVFDN++  V++ G    LGL+DTAGQEDY+RLRPLSY   DVFL+ FS++S +S+ENV +KW+PE+ H+ P  P +LVGT++DLRDD   +         PIT    E+L + + A  Y+ECS+ TQ+ +K VFD AI   L+PP+   K+K
Sbjct:   20 LISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQRGLKNVFDEAILAALEPPETQPKRK 187          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: CDC42_CANFA (Cell division control protein 42 homolog OS=Canis familiaris GN=CDC42 PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 2.598e-44
Identity = 85/168 (50.60%), Postives = 118/168 (70.24%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            +ISYT+N FP++YVPTVFDN++  V++ G    LGL+DTAGQEDY+RLRPLSY   DVFL+ FS++S +S+ENV +KW+PE+ H+ P  P +LVGT++DLRDD   +         PIT    E+L + + A  Y+ECS+ TQ+ +K VFD AI   L+PP+   K+K
Sbjct:   20 LISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQRGLKNVFDEAILAALEPPETQPKRK 187          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RACF2_DICDI (Rho-related protein racF2 OS=Dictyostelium discoideum GN=racF2 PE=3 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 3.393e-44
Identity = 91/172 (52.91%), Postives = 125/172 (72.67%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDD----KQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKRR 608
            +ISYT+N FP++Y+PTVFDN+ AN+++DG   +LGLWDTAGQE+Y+RLRPLSY   DVFL+ FS+IS++S+ENV+ KW  E+ H+APGVPI+LVGTK D+R+D    K+    +   VP    +G E  K I A +Y+E S+ TQ+ VK VFD  I+ V+ P K  KK K++
Sbjct:   20 LISYTTNGFPSEYLPTVFDNYCANLMLDGKPYSLGLWDTAGQEEYDRLRPLSYPQTDVFLICFSIISQSSFENVSTKWFKEVNHHAPGVPIVLVGTKQDIRNDNDSIKKLKERNIELVPY--EKGLEKAKEINA-IYLEASALTQRGVKNVFDQCIRSVIYPNKLNKKPKKK 188          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RACC_ENTHI (Rho-related protein racC OS=Entamoeba histolytica GN=RACC PE=3 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 3.393e-44
Identity = 87/167 (52.10%), Postives = 112/167 (67.07%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL--ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKK 599
            +I YT+N FP DY+PTVFDN+  ++      + L LWDTAGQE+Y++LRPLSY  A +FL+ FS+ S  SY+NV  KW PE+ H+AP VPIILVGTKLD R+D   +      G   I TA+GEEL+  I A  YIECS+KT +N+K VFD A+K VL      + K
Sbjct:   24 LICYTTNEFPKDYIPTVFDNYVVSLTAGTRQIQLALWDTAGQEEYDQLRPLSYSSASIFLICFSVTSSVSYDNVITKWHPEVIHFAPKVPIILVGTKLDTRNDPAIVKRLTEQGMTVINTAKGEELKNRIKAVKYIECSAKTSENLKTVFDEAVKTVLMNKPQQRSK 190          
The following BLAST results are available for this feature:
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CDC42_ASHGO2.350e-4551.79Cell division control protein 42 OS=Ashbya gossypi... [more]
RAC2_CAEEL3.577e-4547.65Ras-related protein rac-2 OS=Caenorhabditis elegan... [more]
RACB_ENTHI4.677e-4556.21Rho-related protein racB (Fragment) OS=Entamoeba h... [more]
RACF1_DICDI1.166e-4453.49Rho-related protein racF1 OS=Dictyostelium discoid... [more]
RACD_ENTHI2.598e-4450.88Rho-related protein racD (Fragment) OS=Entamoeba h... [more]
CDC42_MOUSE2.598e-4450.60Cell division control protein 42 homolog OS=Mus mu... [more]
CDC42_HUMAN2.598e-4450.60Cell division control protein 42 homolog OS=Homo s... [more]
CDC42_CANFA2.598e-4450.60Cell division control protein 42 homolog OS=Canis ... [more]
RACF2_DICDI3.393e-4452.91Rho-related protein racF2 OS=Dictyostelium discoid... [more]
RACC_ENTHI3.393e-4452.10Rho-related protein racC OS=Entamoeba histolytica ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00277 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00277 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623186 ID=BQ623186|Name=BQ623186|organism=Citrus sinensis|type=EST|length=610bp
GTAATAAAGATACTGTCTTAAGTGCACGTGGCGCGAGATGAGTGCATCGA
GGTTCATAAAGTGCGTGACGGTCGGTGACGGCGCCGTCGGCAAGACTTGC
ATGCGTCATTTCTTACACCAGCAACACTTTCCCGACGGATTATGTGCCAA
CAGTATTTGACAATTTCAGTGCAAATGTGGTAGTGGATGGAAGCACTGTT
AATCTTGGGTTGTGGGACACTGCAGGCCAGGAAGATTACAATAGACTAAG
ACCATTGAGCTACCGCGGGGCAGATGTCTTCTTACTCGCATTCTCTCTCA
TTAGCAAGGCCAGCTATGAAAATGTTGCTAAGAAATGGATTCCTGAGTTG
AGGCATTATGCACCTGGTGTTCCAATAATTCTTGTCGGGACGAAGCTCGA
TCTTCGGGATGATAAGCAGTTCCTTGCAGATCACCCTGGTGCAGTGCCAA
TTACCACGGCCCAAGGGGAGGAATTGAGAAAGTTGATAGGTGCTCCTGTT
TACATTGAGTGTAGTTCCAAAACACAACAGAATGTGAAAGCTGTCTTTGA
TGCGGCCATCAAGGTGGTTCTCCAGCCGCCAAAGAACACGAAGAAAAAGA
AGAGAAGGCC
back to top