BQ623186

Overview
NameBQ623186
Unique NameBQ623186
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length610
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12 contig Csv1_Contig12:1..610. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: CDC42_PIG (Cell division control protein 42 homolog OS=Sus scrofa GN=CDC42 PE=2 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 4.432e-44
Identity = 85/168 (50.60%), Postives = 118/168 (70.24%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            +ISYT+N FP++YVPTVFDN++  V++ G    LGL+DTAGQEDY+RLRPLSY   DVFL+ FS++S +S+ENV +KW+PE+ H+ P  P +LVGT++DLRDD   +         PIT    E+L + + A  Y+ECS+ TQ+ +K VFD AI   L+PP+   K+K
Sbjct:   20 LISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQRGLKNVFDEAILSALEPPETQPKRK 187          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: CDC42_RAT (Cell division control protein 42 homolog OS=Rattus norvegicus GN=Cdc42 PE=1 SV=2)

HSP 1 Score: 176.792 bits (447), Expect = 7.559e-44
Identity = 84/168 (50.00%), Postives = 118/168 (70.24%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            +ISYT+N FP++YVPTVFDN++  V++ G    LGL+DTAGQEDY+RLRPLSY   DVFL+ FS++S +S+ENV +KW+PE+ H+ P  P +LVGT++DLRDD   +         PIT    E+L + + A  Y+ECS+ TQ+ +K VFD AI   L+PP+  K ++
Sbjct:   20 LISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRR 187          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: CDC42_BOVIN (Cell division control protein 42 homolog OS=Bos taurus GN=CDC42 PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 7.559e-44
Identity = 84/168 (50.00%), Postives = 118/168 (70.24%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            +ISYT+N FP++YVPTVFDN++  V++ G    LGL+DTAGQEDY+RLRPLSY   DVFL+ FS++S +S+ENV +KW+PE+ H+ P  P +LVGT++DLRDD   +         PIT    E+L + + A  Y+ECS+ TQ+ +K VFD AI   L+PP+  K ++
Sbjct:   20 LISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRR 187          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: CDC42_CHICK (Cell division control protein 42 homolog OS=Gallus gallus GN=CDC42 PE=2 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 9.872e-44
Identity = 84/168 (50.00%), Postives = 118/168 (70.24%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            +ISYT+N FP++YVPTVFDN++  V++ G    LGL+DTAGQEDY+RLRPLSY   DVFL+ FS++S +S+ENV +KW+PE+ H+ P  P +LVGT++DLRDD   +         PIT    E+L + + A  Y+ECS+ TQ+ +K VFD AI   L+PP+  K ++
Sbjct:   20 LISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKTRR 187          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOJ_HUMAN (Rho-related GTP-binding protein RhoJ OS=Homo sapiens GN=RHOJ PE=1 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 2.872e-43
Identity = 87/170 (51.18%), Postives = 119/170 (70.00%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKRR 608
            ++SY ++ FP +YVPTVFD+++  V V G    LGL+DTAGQEDYN+LRPLSY   DVFL+ FS+++ ASY NV ++W+PEL+   P VP +L+GT++DLRDD + LA   +    P+T   G +L K IGA  Y+ECS+ TQ+ +KAVFD AI  +  P    KKKK+R
Sbjct:   38 LMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHLLGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHP----KKKKKR 203          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: CDC42_MACFA (Cell division control protein 42 homolog OS=Macaca fascicularis GN=CDC42 PE=2 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 2.872e-43
Identity = 83/168 (49.40%), Postives = 118/168 (70.24%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            +ISYT+N FP++YVPTVF+N++  V++ G    LGL+DTAGQEDY+RLRPLSY   DVFL+ FS++S +S+ENV +KW+PE+ H+ P  P +LVGT++DLRDD   +         PIT    E+L + + A  Y+ECS+ TQ+ +K VFD AI   L+PP+  K ++
Sbjct:   20 LISYTTNKFPSEYVPTVFNNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRR 187          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOU_HUMAN (Rho-related GTP-binding protein RhoU OS=Homo sapiens GN=RHOU PE=1 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 3.212e-43
Identity = 85/177 (48.02%), Postives = 119/177 (67.23%), Query Frame = 3
Query:   93 RLACVISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL--ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQ---PPKNTKKKKRR 608
            + + V+SYT+N +PT+Y+PT FDNFSA V VDG  V L L DTAGQ+++++LRPL Y   D+FLL FS++S +S++NV++KW+PE+R + P  PIILVGT+ DLR+D + L   D     P+     +   + I A  YIECS+ TQ+N+K VFDAAI   +Q     +  KK K R
Sbjct:   62 KTSLVVSYTTNGYPTEYIPTAFDNFSAVVSVDGRPVRLQLCDTAGQDEFDKLRPLCYTNTDIFLLCFSVVSPSSFQNVSEKWVPEIRCHCPKAPIILVGTQSDLREDVKVLIELDKCKEKPVPEEAAKLCAEEIKAASYIECSALTQKNLKEVFDAAIVAGIQYSDTQQQPKKSKSR 238          

HSP 2 Score: 31.187 bits (69), Expect = 3.212e-43
Identity = 13/18 (72.22%), Postives = 15/18 (83.33%), Query Frame = 2
Query:   50 RFIKCVTVGDGAVGKTCM 103
            R +KCV VGDGAVGKT +
Sbjct:   48 RGVKCVLVGDGAVGKTSL 65          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOU_MOUSE (Rho-related GTP-binding protein RhoU OS=Mus musculus GN=Rhou PE=2 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 5.454e-43
Identity = 83/177 (46.89%), Postives = 117/177 (66.10%), Query Frame = 3
Query:   93 RLACVISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL--ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQ------PPKNTKKK 599
            + + V+SYT+N +PT+Y+PT FDNFSA V VDG  V L L DTAGQ+++++LRPL Y   D+FLL FS++S  S++NV +KW+PE+R + P  PIILVGT+ DLR+D + L   D     P+     +   + + A  YIECS+ TQ+N+K VFDAAI   +Q       PK +K +
Sbjct:   65 KTSLVVSYTTNGYPTEYIPTAFDNFSAVVSVDGRPVRLQLCDTAGQDEFDKLRPLCYTNTDIFLLCFSVVSPTSFQNVGEKWVPEIRRHCPKAPIILVGTQSDLREDVKVLIELDKCKEKPVPEEAAKLCAEEVKAVSYIECSALTQKNLKEVFDAAIVAGIQHSDSQLQPKKSKSR 241          

HSP 2 Score: 31.187 bits (69), Expect = 5.454e-43
Identity = 13/18 (72.22%), Postives = 15/18 (83.33%), Query Frame = 2
Query:   50 RFIKCVTVGDGAVGKTCM 103
            R +KCV VGDGAVGKT +
Sbjct:   51 RGVKCVLVGDGAVGKTSL 68          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOU_BOVIN (Rho-related GTP-binding protein RhoU OS=Bos taurus GN=RHOU PE=2 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 7.109e-43
Identity = 82/173 (47.40%), Postives = 118/173 (68.21%), Query Frame = 3
Query:   93 RLACVISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL--ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKR 605
            + + V+SYT+N +PT+Y+PT FDNFSA V VDG  V L L DTAGQ+++++LRPL Y  AD+FLL FS++  +S++NV++KW+PE+R + P  PIILVGT+ DLR+D + L   D     P+         + I A  YIECS+ TQ+N+K VFDAAI   +Q   + ++ K+
Sbjct:   59 KTSLVVSYTTNGYPTEYIPTAFDNFSAVVSVDGRPVKLQLCDTAGQDEFDKLRPLCYTNADIFLLCFSVVGPSSFQNVSEKWVPEIRCHCPKAPIILVGTQSDLREDVKVLIELDKCKEKPVPEEAARLCAEEIKATSYIECSALTQKNLKEVFDAAIVAGIQYSDSQQQPKK 231          

HSP 2 Score: 30.4166 bits (67), Expect = 7.109e-43
Identity = 12/16 (75.00%), Postives = 14/16 (87.50%), Query Frame = 2
Query:   56 IKCVTVGDGAVGKTCM 103
            +KCV VGDGAVGKT +
Sbjct:   47 VKCVLVGDGAVGKTSL 62          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOJ_MOUSE (Rho-related GTP-binding protein RhoJ OS=Mus musculus GN=Rhoj PE=1 SV=2)

HSP 1 Score: 173.326 bits (438), Expect = 8.358e-43
Identity = 84/165 (50.91%), Postives = 115/165 (69.70%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTK 593
            ++SY ++ FP +YVPTVFD+++  V V G    LGL+DTAGQEDYN+LRPLSY   DVFL+ FS+++ ASY NV ++W+PEL+   P VP +L+GT++DLRDD + LA   +    P+T   G +L K IGA  Y+ECS+ TQ+ +KAVFD AI  +  P K  K
Sbjct:   38 LMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHLLGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKK 202          
The following BLAST results are available for this feature:
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CDC42_PIG4.432e-4450.60Cell division control protein 42 homolog OS=Sus sc... [more]
CDC42_RAT7.559e-4450.00Cell division control protein 42 homolog OS=Rattus... [more]
CDC42_BOVIN7.559e-4450.00Cell division control protein 42 homolog OS=Bos ta... [more]
CDC42_CHICK9.872e-4450.00Cell division control protein 42 homolog OS=Gallus... [more]
RHOJ_HUMAN2.872e-4351.18Rho-related GTP-binding protein RhoJ OS=Homo sapie... [more]
CDC42_MACFA2.872e-4349.40Cell division control protein 42 homolog OS=Macaca... [more]
RHOU_HUMAN3.212e-4348.02Rho-related GTP-binding protein RhoU OS=Homo sapie... [more]
RHOU_MOUSE5.454e-4346.89Rho-related GTP-binding protein RhoU OS=Mus muscul... [more]
RHOU_BOVIN7.109e-4347.40Rho-related GTP-binding protein RhoU OS=Bos taurus... [more]
RHOJ_MOUSE8.358e-4350.91Rho-related GTP-binding protein RhoJ OS=Mus muscul... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00277 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00277 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623186 ID=BQ623186|Name=BQ623186|organism=Citrus sinensis|type=EST|length=610bp
GTAATAAAGATACTGTCTTAAGTGCACGTGGCGCGAGATGAGTGCATCGA
GGTTCATAAAGTGCGTGACGGTCGGTGACGGCGCCGTCGGCAAGACTTGC
ATGCGTCATTTCTTACACCAGCAACACTTTCCCGACGGATTATGTGCCAA
CAGTATTTGACAATTTCAGTGCAAATGTGGTAGTGGATGGAAGCACTGTT
AATCTTGGGTTGTGGGACACTGCAGGCCAGGAAGATTACAATAGACTAAG
ACCATTGAGCTACCGCGGGGCAGATGTCTTCTTACTCGCATTCTCTCTCA
TTAGCAAGGCCAGCTATGAAAATGTTGCTAAGAAATGGATTCCTGAGTTG
AGGCATTATGCACCTGGTGTTCCAATAATTCTTGTCGGGACGAAGCTCGA
TCTTCGGGATGATAAGCAGTTCCTTGCAGATCACCCTGGTGCAGTGCCAA
TTACCACGGCCCAAGGGGAGGAATTGAGAAAGTTGATAGGTGCTCCTGTT
TACATTGAGTGTAGTTCCAAAACACAACAGAATGTGAAAGCTGTCTTTGA
TGCGGCCATCAAGGTGGTTCTCCAGCCGCCAAAGAACACGAAGAAAAAGA
AGAGAAGGCC
back to top