BQ623186

Overview
NameBQ623186
Unique NameBQ623186
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length610
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12 contig Csv1_Contig12:1..610. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOL_DROME (Ras-like GTP-binding protein RhoL OS=Drosophila melanogaster GN=RhoL PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 3.176e-42
Identity = 83/167 (49.70%), Postives = 117/167 (70.06%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLR--DDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKK 599
            +I+YT N FP +Y+PTVFDN + N+ VD    NL LWDTAGQEDY RLRPLSY   + FLL +S+ S+ S+ENV  KW PE+RH++  VP++LVGTKLDLR  + ++F         +TT +G+++RK I A   +ECS+K +QN++ VF+ A++ V + PK T K+
Sbjct:   28 LITYTRNEFPEEYIPTVFDNHACNIAVDDRDYNLTLWDTAGQEDYERLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTKLDLRIPNSEKF---------VTTQEGKKMRKEIHAFNLVECSAKKKQNLQQVFEEAVRAVERKPKTTSKQ 185          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RACH_DICDI (Rho-related protein racH OS=Dictyostelium discoideum GN=racH PE=3 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 9.240e-42
Identity = 88/169 (52.07%), Postives = 114/169 (67.46%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGV-PIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKRR 608
            +ISYT+N+FP +YVPTVFDN++AN +V+ + +NLGLWDTAG E+YN  RPLSY G DVF++ FSLIS+ S+ENV KKW PE+      V PIILVGTKLDLR   +          +T   GE++R  IGA  Y ECS+ TQ  +  VF+ A +VVL PP   +  K +
Sbjct:   21 LISYTTNSFPGEYVPTVFDNYNANAIVNNTPINLGLWDTAGSEEYNSFRPLSYPGTDVFIICFSLISQTSFENVIKKWHPEIIQNMEQVPPIILVGTKLDLRGKGK-----SEEKEVTPEMGEQMRAAIGAYKYSECSALTQDGLTTVFEEAGRVVLFPPSKEELAKSK 184          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHO1_CAEEL (Ras-like GTP-binding protein rhoA OS=Caenorhabditis elegans GN=rho-1 PE=2 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.022e-40
Identity = 82/167 (49.10%), Postives = 109/167 (65.27%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKK 599
            +I ++ + FP  YVPTVF+N+ A++ VDG  V L LWDTAGQEDY+RLRPLSY   DV L+ FS+ S  S EN+ +KW PE+RH+ P VPIILVG K DLR D Q + +       P+   QG  + + IGA  Y+ECS+KT+  ++ VF+ A +  LQ  K  K K
Sbjct:   22 LIVFSKDQFPDVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVRHFCPNVPIILVGNKRDLRSDPQTVRELAKMKQEPVKPEQGRAIAEQIGAFAYLECSAKTKDGIREVFEKATQAALQQKKKKKSK 188          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOV_RAT (Rho-related GTP-binding protein RhoV OS=Rattus norvegicus GN=Rhov PE=1 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 1.087e-40
Identity = 79/170 (46.47%), Postives = 110/170 (64.71%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL-----ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKK 599
            ++SYT N +P+ Y PT  D FS  V+VDG+ V + LWDTAGQED++RLR L Y   DVFL  FS++  +S++N+ +KW+PE+R + P  P++LVGT+ DLRDD   L         G VP   AQG  L + I A  Y+ECS+ TQ+N+K VFD+AI   ++     +KK
Sbjct:   48 IVSYTCNGYPSRYRPTALDTFSVQVLVDGAPVRIELWDTAGQEDFDRLRSLCYPDTDVFLACFSVVQPSSFQNITEKWLPEIRTHNPQAPVLLVGTQADLRDDVNVLIQLDQGGREGPVPEPQAQG--LAEKIRACCYLECSALTQKNLKEVFDSAILSAIEHKARLEKK 215          

HSP 2 Score: 29.261 bits (64), Expect = 1.087e-40
Identity = 12/16 (75.00%), Postives = 14/16 (87.50%), Query Frame = 2
Query:   56 IKCVTVGDGAVGKTCM 103
            IKCV VGDGAVGK+ +
Sbjct:   32 IKCVLVGDGAVGKSSL 47          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOA_EMENI (GTP-binding protein rhoA OS=Emericella nidulans GN=rhoA PE=3 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.334e-40
Identity = 84/168 (50.00%), Postives = 113/168 (67.26%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            +I ++  TFP  YVPTVF+N+ A+V VDG  V L LWDTAGQEDY+RLRPLSY  + V L+ F++ S  S +NV +KWI E+ H+  G+PIILVG K DLR D + + +       P+T  QGEE+RK IGA  Y+ECS++T + V+ VF+AA +  L    +  KKK
Sbjct:   22 LIVFSKGTFPEVYVPTVFENYVADVEVDGKHVELALWDTAGQEDYDRLRPLSYPDSHVILICFAVDSPDSLDNVQEKWISEVLHFCQGLPIILVGCKKDLRHDPKTIEELNKTSQKPVTPEQGEEVRKKIGAYKYLECSARTNEGVREVFEAATRAALLTKTHKSKKK 189          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOV_MOUSE (Rho-related GTP-binding protein RhoV OS=Mus musculus GN=Rhov PE=2 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 1.417e-40
Identity = 79/170 (46.47%), Postives = 109/170 (64.12%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL-----ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKK 599
            ++SYT N +P  Y PT  D FS  V+VDG+ V + LWDTAGQED++RLR L Y   DVFL  FS++  +S++N+ +KW+PE+R + P  P++LVGT+ DLRDD   L         G VP   AQG  L + I A  Y+ECS+ TQ+N+K VFD+AI   ++     +KK
Sbjct:   48 IVSYTCNGYPARYRPTALDTFSVQVLVDGAPVRIELWDTAGQEDFDRLRSLCYPDTDVFLACFSVVQPSSFQNITEKWLPEIRTHNPQAPVLLVGTQADLRDDVNVLIQLDQGGREGPVPQPQAQG--LAEKIRACCYLECSALTQKNLKEVFDSAILSAIEHKARLEKK 215          

HSP 2 Score: 29.261 bits (64), Expect = 1.417e-40
Identity = 12/16 (75.00%), Postives = 14/16 (87.50%), Query Frame = 2
Query:   56 IKCVTVGDGAVGKTCM 103
            IKCV VGDGAVGK+ +
Sbjct:   32 IKCVLVGDGAVGKSSL 47          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOV_HUMAN (Rho-related GTP-binding protein RhoV OS=Homo sapiens GN=RHOV PE=2 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 1.417e-40
Identity = 79/170 (46.47%), Postives = 109/170 (64.12%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL-----ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKK 599
            ++SYT N +P  Y PT  D FS  V+VDG+ V + LWDTAGQED++RLR L Y   DVFL  FS++  +S++N+ +KW+PE+R + P  P++LVGT+ DLRDD   L         G VP   AQG  L + I A  Y+ECS+ TQ+N+K VFD+AI   ++     +KK
Sbjct:   48 IVSYTCNGYPARYRPTALDTFSVQVLVDGAPVRIELWDTAGQEDFDRLRSLCYPDTDVFLACFSVVQPSSFQNITEKWLPEIRTHNPQAPVLLVGTQADLRDDVNVLIQLDQGGREGPVPQPQAQG--LAEKIRACCYLECSALTQKNLKEVFDSAILSAIEHKARLEKK 215          

HSP 2 Score: 29.261 bits (64), Expect = 1.417e-40
Identity = 12/16 (75.00%), Postives = 14/16 (87.50%), Query Frame = 2
Query:   56 IKCVTVGDGAVGKTCM 103
            IKCV VGDGAVGK+ +
Sbjct:   32 IKCVLVGDGAVGKSSL 47          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHO1_CANAL (GTP-binding protein RHO1 OS=Candida albicans GN=RHO1 PE=3 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 1.743e-40
Identity = 83/169 (49.11%), Postives = 117/169 (69.23%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL--ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKR 605
            +I ++  TFP  YVPTVF+N+ A+V VDG  V L LWDTAGQEDY+RLRPLSY  ++V L+ FS+ S  S +NV +KWI E+ H+  GVPIILVG K DLRDD   +         P++T++G+++ + IGA  Y+ECS+KT + V+ VF+AA +  L+  +  +KKK+
Sbjct:   26 LIVFSKGTFPEVYVPTVFENYVADVEVDGRKVELALWDTAGQEDYDRLRPLSYPDSNVILICFSVDSPDSLDNVLEKWISEVLHFCQGVPIILVGCKSDLRDDPHTIEALRQQQQQPVSTSEGQQVAQRIGAADYLECSAKTGRGVREVFEAATRASLRVKEKKEKKKK 194          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RACE_DICDI (Rho-related protein racE OS=Dictyostelium discoideum GN=racE PE=1 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 3.882e-40
Identity = 83/166 (50.00%), Postives = 110/166 (66.27%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            +I Y  N FP DYVPTVF+N++A        + + LWDTAGQE+Y+RLRPLSY GADV LL FS IS++SYE +  KW PE+ HY P VP ILVGTK+DLR+ +    +     PIT   G  ++K I A  Y+E S+KT+Q ++ VF AAI++VL+     KK +
Sbjct:   28 LICYAQNDFPVDYVPTVFENYTATRKRGNEDIKVHLWDTAGQEEYDRLRPLSYPGADVVLLCFSTISQSSYEAIRDKWAPEVNHYIPDVPSILVGTKIDLREQQHPDPNSGKFEPITADMGISMQKQIKAKKYLEVSAKTRQGLEEVFSAAIEIVLESRGMDKKSQ 193          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOV_BOVIN (Rho-related GTP-binding protein RhoV OS=Bos taurus GN=Rhov PE=2 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 4.084e-40
Identity = 79/170 (46.47%), Postives = 108/170 (63.53%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL-----ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKK 599
            ++SYT N +P  Y PT  D FS  V+VDG+ V + LWDTAGQED +RLR L Y   DVFL  FS++  +S++N+ +KW+PE+R + P  P++LVGT+ DLRDD   L         G VP   AQG  L + I A  Y+ECS+ TQ+N+K VFD+AI   ++     +KK
Sbjct:   48 IVSYTCNGYPARYRPTALDTFSVQVLVDGAPVRIELWDTAGQEDLDRLRSLCYPDTDVFLACFSVVQPSSFQNITEKWLPEIRTHNPQAPVLLVGTQADLRDDVNVLIQLDQGGREGPVPQPQAQG--LAEKIRACCYLECSALTQKNLKEVFDSAILSAIEHKARLEKK 215          

HSP 2 Score: 29.261 bits (64), Expect = 4.084e-40
Identity = 12/16 (75.00%), Postives = 14/16 (87.50%), Query Frame = 2
Query:   56 IKCVTVGDGAVGKTCM 103
            IKCV VGDGAVGK+ +
Sbjct:   32 IKCVLVGDGAVGKSSL 47          
The following BLAST results are available for this feature:
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RHOL_DROME3.176e-4249.70Ras-like GTP-binding protein RhoL OS=Drosophila me... [more]
RACH_DICDI9.240e-4252.07Rho-related protein racH OS=Dictyostelium discoide... [more]
RHO1_CAEEL1.022e-4049.10Ras-like GTP-binding protein rhoA OS=Caenorhabditi... [more]
RHOV_RAT1.087e-4046.47Rho-related GTP-binding protein RhoV OS=Rattus nor... [more]
RHOA_EMENI1.334e-4050.00GTP-binding protein rhoA OS=Emericella nidulans GN... [more]
RHOV_MOUSE1.417e-4046.47Rho-related GTP-binding protein RhoV OS=Mus muscul... [more]
RHOV_HUMAN1.417e-4046.47Rho-related GTP-binding protein RhoV OS=Homo sapie... [more]
RHO1_CANAL1.743e-4049.11GTP-binding protein RHO1 OS=Candida albicans GN=RH... [more]
RACE_DICDI3.882e-4050.00Rho-related protein racE OS=Dictyostelium discoide... [more]
RHOV_BOVIN4.084e-4046.47Rho-related GTP-binding protein RhoV OS=Bos taurus... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00277 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00277 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623186 ID=BQ623186|Name=BQ623186|organism=Citrus sinensis|type=EST|length=610bp
GTAATAAAGATACTGTCTTAAGTGCACGTGGCGCGAGATGAGTGCATCGA
GGTTCATAAAGTGCGTGACGGTCGGTGACGGCGCCGTCGGCAAGACTTGC
ATGCGTCATTTCTTACACCAGCAACACTTTCCCGACGGATTATGTGCCAA
CAGTATTTGACAATTTCAGTGCAAATGTGGTAGTGGATGGAAGCACTGTT
AATCTTGGGTTGTGGGACACTGCAGGCCAGGAAGATTACAATAGACTAAG
ACCATTGAGCTACCGCGGGGCAGATGTCTTCTTACTCGCATTCTCTCTCA
TTAGCAAGGCCAGCTATGAAAATGTTGCTAAGAAATGGATTCCTGAGTTG
AGGCATTATGCACCTGGTGTTCCAATAATTCTTGTCGGGACGAAGCTCGA
TCTTCGGGATGATAAGCAGTTCCTTGCAGATCACCCTGGTGCAGTGCCAA
TTACCACGGCCCAAGGGGAGGAATTGAGAAAGTTGATAGGTGCTCCTGTT
TACATTGAGTGTAGTTCCAAAACACAACAGAATGTGAAAGCTGTCTTTGA
TGCGGCCATCAAGGTGGTTCTCCAGCCGCCAAAGAACACGAAGAAAAAGA
AGAGAAGGCC
back to top