BQ623186

Overview
NameBQ623186
Unique NameBQ623186
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length610
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12 contig Csv1_Contig12:1..610. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOC_CHICK (Rho-related GTP-binding protein RhoC OS=Gallus gallus GN=RHOC PE=1 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 4.292e-39
Identity = 79/167 (47.31%), Postives = 111/167 (66.47%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKK 599
            +I ++ + FP  YVPTVF+N+ A++ VDG  V L LWDTAGQEDY+RLRPLSY   DV L+ FS+ S  S EN+ +KW PE++H+ P VPIILVG K DLR+D+    +       P+   +G ++   I A  Y+ECS+KT++ V+ VF+ A +  LQ  KN K++
Sbjct:   22 LIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRINAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKKRR 188          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOA_CANFA (Transforming protein RhoA OS=Canis familiaris GN=RHOA PE=2 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 4.292e-39
Identity = 79/166 (47.59%), Postives = 109/166 (65.66%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKK 596
            +I ++ + FP  YVPTVF+N+ A++ VDG  V L LWDTAGQEDY+RLRPLSY   DV L+ FS+ S  S EN+ +KW PE++H+ P VPIILVG K DLR+D+    +       P+   +G ++   IGA  Y+ECS+KT+  V+ VF+ A +  LQ  +  KK
Sbjct:   22 LIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPTEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKK 187          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOA_RAT (Transforming protein RhoA OS=Rattus norvegicus GN=Rhoa PE=2 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 5.606e-39
Identity = 79/166 (47.59%), Postives = 109/166 (65.66%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKK 596
            +I ++ + FP  YVPTVF+N+ A++ VDG  V L LWDTAGQEDY+RLRPLSY   DV L+ FS+ S  S EN+ +KW PE++H+ P VPIILVG K DLR+D+    +       P+   +G ++   IGA  Y+ECS+KT+  V+ VF+ A +  LQ  +  KK
Sbjct:   22 LIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKK 187          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOA_PONAB (Transforming protein RhoA OS=Pongo abelii GN=RHOA PE=2 SV=2)

HSP 1 Score: 160.614 bits (405), Expect = 5.606e-39
Identity = 79/166 (47.59%), Postives = 109/166 (65.66%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKK 596
            +I ++ + FP  YVPTVF+N+ A++ VDG  V L LWDTAGQEDY+RLRPLSY   DV L+ FS+ S  S EN+ +KW PE++H+ P VPIILVG K DLR+D+    +       P+   +G ++   IGA  Y+ECS+KT+  V+ VF+ A +  LQ  +  KK
Sbjct:   22 LIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKK 187          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOA_MOUSE (Transforming protein RhoA OS=Mus musculus GN=Rhoa PE=1 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 5.606e-39
Identity = 79/166 (47.59%), Postives = 109/166 (65.66%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKK 596
            +I ++ + FP  YVPTVF+N+ A++ VDG  V L LWDTAGQEDY+RLRPLSY   DV L+ FS+ S  S EN+ +KW PE++H+ P VPIILVG K DLR+D+    +       P+   +G ++   IGA  Y+ECS+KT+  V+ VF+ A +  LQ  +  KK
Sbjct:   22 LIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKK 187          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOA_HUMAN (Transforming protein RhoA OS=Homo sapiens GN=RHOA PE=1 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 5.606e-39
Identity = 79/166 (47.59%), Postives = 109/166 (65.66%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKK 596
            +I ++ + FP  YVPTVF+N+ A++ VDG  V L LWDTAGQEDY+RLRPLSY   DV L+ FS+ S  S EN+ +KW PE++H+ P VPIILVG K DLR+D+    +       P+   +G ++   IGA  Y+ECS+KT+  V+ VF+ A +  LQ  +  KK
Sbjct:   22 LIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKK 187          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOA_BOVIN (Transforming protein RhoA OS=Bos taurus GN=RHOA PE=1 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 5.606e-39
Identity = 79/166 (47.59%), Postives = 109/166 (65.66%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKK 596
            +I ++ + FP  YVPTVF+N+ A++ VDG  V L LWDTAGQEDY+RLRPLSY   DV L+ FS+ S  S EN+ +KW PE++H+ P VPIILVG K DLR+D+    +       P+   +G ++   IGA  Y+ECS+KT+  V+ VF+ A +  LQ  +  KK
Sbjct:   22 LIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKK 187          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHO1_YEAST (GTP-binding protein RHO1 OS=Saccharomyces cerevisiae GN=RHO1 PE=1 SV=3)

HSP 1 Score: 160.614 bits (405), Expect = 5.606e-39
Identity = 85/178 (47.75%), Postives = 115/178 (64.61%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVL--------QPPKNTKKKKRR 608
            +I ++   FP  YVPTVF+N+ A+V VDG  V L LWDTAGQEDY+RLRPLSY  ++V L+ FS+    S ENV +KWI E+ H+  GVPIILVG K+DLR+D Q +      G  P+T+ +G+ +   IGA  Y ECS+KT   V+ VF+AA +  L        +  KNT +KK++
Sbjct:   27 LIVFSKGQFPEVYVPTVFENYVADVEVDGRRVELALWDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFCQGVPIILVGCKVDLRNDPQTIEQLRQEGQQPVTSQEGQSVADQIGATGYYECSAKTGYGVREVFEAATRASLMGKSKTNGKAKKNTTEKKKK 204          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHO1_KLULA (GTP-binding protein Rho1 OS=Kluyveromyces lactis GN=RHO1 PE=3 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 5.606e-39
Identity = 86/176 (48.86%), Postives = 112/176 (63.64%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVL------QPPKNTKKKKRR 608
            +I +    FP  YVPTVFDN+ A+V VDG  V L LWDTAGQEDY+RLRPLSY  ++V L+ +S+    S ENV +KWI E+ H+  GVPIILVG K DLR+D Q + +    G  P++ AQ +E+   IGA  YIECS+KT   V+ VF+AA +  L        PK    KK++
Sbjct:   29 LIVFAKGKFPQVYVPTVFDNYVADVEVDGRRVELALWDTAGQEDYDRLRPLSYPDSNVVLICYSIDLPDSLENVMEKWISEVLHFCQGVPIILVGCKADLRNDPQVVEELRAQGLQPVSQAQAQEVADQIGAVDYIECSAKTGYGVREVFEAATRASLVGKQGKSKPKTKSSKKKK 204          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOC_PONAB (Rho-related GTP-binding protein RhoC OS=Pongo abelii GN=RHOC PE=2 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 7.322e-39
Identity = 78/167 (46.71%), Postives = 111/167 (66.47%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKK 599
            +I ++ + FP  YVPTVF+N+ A++ VDG  V L LWDTAGQEDY+RLRPLSY   DV L+ FS+ S  S EN+ +KW PE++H+ P VPIILVG K DLR D+    +       P+ + +G ++   I A  Y+ECS+KT++ V+ VF+ A +  LQ  KN +++
Sbjct:   22 LIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRR 188          
The following BLAST results are available for this feature:
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RHOC_CHICK4.292e-3947.31Rho-related GTP-binding protein RhoC OS=Gallus gal... [more]
RHOA_CANFA4.292e-3947.59Transforming protein RhoA OS=Canis familiaris GN=R... [more]
RHOA_RAT5.606e-3947.59Transforming protein RhoA OS=Rattus norvegicus GN=... [more]
RHOA_PONAB5.606e-3947.59Transforming protein RhoA OS=Pongo abelii GN=RHOA ... [more]
RHOA_MOUSE5.606e-3947.59Transforming protein RhoA OS=Mus musculus GN=Rhoa ... [more]
RHOA_HUMAN5.606e-3947.59Transforming protein RhoA OS=Homo sapiens GN=RHOA ... [more]
RHOA_BOVIN5.606e-3947.59Transforming protein RhoA OS=Bos taurus GN=RHOA PE... [more]
RHO1_YEAST5.606e-3947.75GTP-binding protein RHO1 OS=Saccharomyces cerevisi... [more]
RHO1_KLULA5.606e-3948.86GTP-binding protein Rho1 OS=Kluyveromyces lactis G... [more]
RHOC_PONAB7.322e-3946.71Rho-related GTP-binding protein RhoC OS=Pongo abel... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00277 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00277 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623186 ID=BQ623186|Name=BQ623186|organism=Citrus sinensis|type=EST|length=610bp
GTAATAAAGATACTGTCTTAAGTGCACGTGGCGCGAGATGAGTGCATCGA
GGTTCATAAAGTGCGTGACGGTCGGTGACGGCGCCGTCGGCAAGACTTGC
ATGCGTCATTTCTTACACCAGCAACACTTTCCCGACGGATTATGTGCCAA
CAGTATTTGACAATTTCAGTGCAAATGTGGTAGTGGATGGAAGCACTGTT
AATCTTGGGTTGTGGGACACTGCAGGCCAGGAAGATTACAATAGACTAAG
ACCATTGAGCTACCGCGGGGCAGATGTCTTCTTACTCGCATTCTCTCTCA
TTAGCAAGGCCAGCTATGAAAATGTTGCTAAGAAATGGATTCCTGAGTTG
AGGCATTATGCACCTGGTGTTCCAATAATTCTTGTCGGGACGAAGCTCGA
TCTTCGGGATGATAAGCAGTTCCTTGCAGATCACCCTGGTGCAGTGCCAA
TTACCACGGCCCAAGGGGAGGAATTGAGAAAGTTGATAGGTGCTCCTGTT
TACATTGAGTGTAGTTCCAAAACACAACAGAATGTGAAAGCTGTCTTTGA
TGCGGCCATCAAGGTGGTTCTCCAGCCGCCAAAGAACACGAAGAAAAAGA
AGAGAAGGCC
back to top