BQ623191

Overview
NameBQ623191
Unique NameBQ623191
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length520
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig383 contig Csv1_Contig383:27..546. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_PROMH (Chaperone protein dnaJ OS=Proteus mirabilis (strain HI4320) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 7.066e-12
Identity = 32/67 (47.76%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +D+Y++L +   A E+EI+  Y RLA+K+HPD+ +    + S+F+EI EAY+VLSDP KR  YD  G
Sbjct:    4 RDFYEVLGLSKTADEKEIKRAYKRLAMKYHPDRNQGDKDSESKFKEIKEAYEVLSDPQKRAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_METCA (Chaperone protein dnaJ OS=Methylococcus capsulatus GN=dnaJ PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 7.066e-12
Identity = 32/67 (47.76%), Postives = 45/67 (67.16%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY+ L V  +A++ +I+  + RLA+K+HPD+ KD   A  RF+ + EAY VLSDP KR  YD  G
Sbjct:    4 EDYYETLGVPRNASDSDIKKAFRRLAMKYHPDRNKDNPEAEERFKSVKEAYDVLSDPKKRSAYDQFG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_FINM2 (Chaperone protein dnaJ OS=Finegoldia magna (strain ATCC 29328) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 7.066e-12
Identity = 34/67 (50.75%), Postives = 48/67 (71.64%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            K+ Y+ILEV+ +AT+EEI+ +Y RLA K+HPD       A ++F+EIN AY+VL D  KR++YD  G
Sbjct:    2 KNLYEILEVNENATQEEIKKSYRRLAKKYHPDINSGDSEAENKFKEINGAYEVLGDKEKRKKYDMYG 68          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_EDWI9 (Chaperone protein dnaJ OS=Edwardsiella ictaluri (strain 93-146) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 7.066e-12
Identity = 33/67 (49.25%), Postives = 45/67 (67.16%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            KDYY+IL V  +A E EI+  Y RLA+K+HPD+ +    A  +F+EI EAY++L+D  KR  YD  G
Sbjct:    4 KDYYEILGVSREADEREIKKAYKRLAMKYHPDRNQGDKEAEDKFKEIKEAYEILTDAQKRAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_CHRVO (Chaperone protein dnaJ OS=Chromobacterium violaceum GN=dnaJ PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 7.066e-12
Identity = 30/67 (44.78%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY +L V+ DA++++I+  Y +LA+K+HPD+  D   A  +F+E+ EAY++LSD  KR  YD  G
Sbjct:    4 RDYYDVLGVNRDASDDDIKKAYRKLAMKYHPDRNPDSKEAEDKFKEVKEAYEILSDSQKRGAYDQFG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_BACST (Chaperone protein dnaJ OS=Bacillus stearothermophilus GN=dnaJ PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 7.066e-12
Identity = 35/67 (52.24%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY+IL V  +AT+EEI+  Y +L+ K+HPD  K+ D A  +F+EI EAY+VLSD  KR  YD  G
Sbjct:    4 RDYYEILGVSKNATKEEIKKAYRKLSKKYHPDVNKEPD-AAEKFKEIKEAYEVLSDDQKRAHYDQFG 69          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_BACSK (Chaperone protein dnaJ OS=Bacillus clausii (strain KSM-K16) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 7.066e-12
Identity = 32/67 (47.76%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY++L VD +A+ EE++  Y +LA K+HPD  K+ D A ++F+E+ EAY  LSDP K+  YD  G
Sbjct:    4 RDYYEVLGVDRNASVEEVKKAYRKLARKYHPDVNKEED-AEAKFKEVKEAYDTLSDPQKKARYDQFG 69          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNJ10_CAEEL (DnaJ homolog dnj-10 OS=Caenorhabditis elegans GN=dnj-10 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 9.229e-12
Identity = 34/67 (50.75%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYYK L VD  +  + I+  Y +LA K+HPD  K ++  T +FQEI+EAY+VLSD  KR+EYD+ G
Sbjct:   43 EDYYKTLGVDKKSDAKAIKKAYFQLAKKYHPDVNKTKEAQT-KFQEISEAYEVLSDDTKRQEYDAYG 108          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_SULNB (Chaperone protein dnaJ OS=Sulfurovum sp. (strain NBC37-1) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 9.229e-12
Identity = 33/66 (50.00%), Postives = 44/66 (66.67%), Query Frame = 1
Query:  130 DYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            DYY++LEV  D +  E++  Y +LALK+HPD+  D   A  +F+ +NEAYQVLSD  KR  YD  G
Sbjct:    5 DYYEVLEVSRDCSGAELKKAYRKLALKYHPDRNPDDQEAEEKFKIVNEAYQVLSDDEKRTIYDRYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_PORGI (Chaperone protein dnaJ OS=Porphyromonas gingivalis GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 9.229e-12
Identity = 31/71 (43.66%), Postives = 48/71 (67.61%), Query Frame = 1
Query:  115 LAKPKDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +A+ +DYY++L V  +AT++E++  Y + A+++HPDK      A   F+E+ EAY VLSDP KR +YD  G
Sbjct:    1 MAEKRDYYEVLGVSKNATDDELKKAYRKKAIQYHPDKNPGDKEAEEHFKEVAEAYDVLSDPQKRSQYDQFG 71          
The following BLAST results are available for this feature:
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 356
Match NameE-valueIdentityDescription
DNAJ_PROMH7.066e-1247.76Chaperone protein dnaJ OS=Proteus mirabilis (strai... [more]
DNAJ_METCA7.066e-1247.76Chaperone protein dnaJ OS=Methylococcus capsulatus... [more]
DNAJ_FINM27.066e-1250.75Chaperone protein dnaJ OS=Finegoldia magna (strain... [more]
DNAJ_EDWI97.066e-1249.25Chaperone protein dnaJ OS=Edwardsiella ictaluri (s... [more]
DNAJ_CHRVO7.066e-1244.78Chaperone protein dnaJ OS=Chromobacterium violaceu... [more]
DNAJ_BACST7.066e-1252.24Chaperone protein dnaJ OS=Bacillus stearothermophi... [more]
DNAJ_BACSK7.066e-1247.76Chaperone protein dnaJ OS=Bacillus clausii (strain... [more]
DNJ10_CAEEL9.229e-1250.75DnaJ homolog dnj-10 OS=Caenorhabditis elegans GN=d... [more]
DNAJ_SULNB9.229e-1250.00Chaperone protein dnaJ OS=Sulfurovum sp. (strain N... [more]
DNAJ_PORGI9.229e-1243.66Chaperone protein dnaJ OS=Porphyromonas gingivalis... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00282 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00282 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623191 ID=BQ623191|Name=BQ623191|organism=Citrus sinensis|type=EST|length=520bp
GTTTGTGTCCCCTCTACTAAAGAGGTCATGATGTGGGACGAATGGGTCGA
TTGCAACAATAACGATGAACAAACCCAACAGGATTCCCATGTCAATTTTG
ATTTTCTTTCTCTTCTCGCCAAACCCAAGGATTATTATAAAATATTGGAA
GTTGATTACGATGCCACGGAGGAAGAAATTAGGTCCAATTACATTCGTCT
AGCGCTGAAATGGCACCCAGATAAGCAAAAGGATCGAGATTGTGCAACTT
CGAGATTTCAAGAGATAAACGAGGCTTACCAGGTTTTGAGCGATCCTGTC
AAAAGGAGAGAATATGACAGCAAAGGGATGTTGCACATATATGATCGCAA
CATAATTGAGTATCTTAATCGCTACAAGGGCTTAATATTAACTTGCAATG
GTCTTGGGATGAGGCATTCAATTGTGTAATATGTTGTCAGCACAGTTGGG
GCAGTTCATATTGGGAGGCATAGAATTACCAATGCTGCAAATAGCATTGA
GGGCATGGAGAATAGCAGTT
back to top