BQ623191

Overview
NameBQ623191
Unique NameBQ623191
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length520
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig383 contig Csv1_Contig383:27..546. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_LEPIN (Chaperone protein dnaJ OS=Leptospira interrogans GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 9.229e-12
Identity = 32/67 (47.76%), Postives = 44/67 (65.67%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            + YY IL V   A +EEI+S Y +LA+K+HPDK K    +  +F+E  EAY++L DP KR+ YD  G
Sbjct:    4 RSYYDILGVSKSANDEEIKSAYRKLAIKYHPDKNKGNKESEEKFKEATEAYEILRDPKKRQAYDQFG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_LEPIC (Chaperone protein dnaJ OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 9.229e-12
Identity = 32/67 (47.76%), Postives = 44/67 (65.67%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            + YY IL V   A +EEI+S Y +LA+K+HPDK K    +  +F+E  EAY++L DP KR+ YD  G
Sbjct:    4 RSYYDILGVSKSANDEEIKSAYRKLAIKYHPDKNKGNKESEEKFKEATEAYEILRDPKKRQAYDQFG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_LEPBL (Chaperone protein dnaJ OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 9.229e-12
Identity = 32/67 (47.76%), Postives = 44/67 (65.67%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            + YY IL V   A +EEI+S Y +LA+K+HPDK K    +  +F+E  EAY++L DP KR+ YD  G
Sbjct:    4 RSYYDILGVSKSANDEEIKSAYRKLAIKYHPDKNKGNKESEEKFKEATEAYEILRDPKKRQAYDQFG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_LEPBJ (Chaperone protein dnaJ OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 9.229e-12
Identity = 32/67 (47.76%), Postives = 44/67 (65.67%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            + YY IL V   A +EEI+S Y +LA+K+HPDK K    +  +F+E  EAY++L DP KR+ YD  G
Sbjct:    4 RSYYDILGVSKSANDEEIKSAYRKLAIKYHPDKNKGNKESEEKFKEATEAYEILRDPKKRQAYDQFG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_LACSS (Chaperone protein dnaJ OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 9.229e-12
Identity = 33/71 (46.48%), Postives = 49/71 (69.01%), Query Frame = 1
Query:  115 LAKPKDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +A+ +DYY +L V  DA+++EI+  Y +L+ K+HPD  K  D A ++F+E+ EAY+ LSDP KR  YD  G
Sbjct:    1 MAEKRDYYDVLGVGRDASDDEIKKAYRKLSKKYHPDINKAPD-AEAKFKEVTEAYEALSDPQKRAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_LACSK (Chaperone protein dnaJ OS=Lactobacillus sakei GN=dnaJ PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 9.229e-12
Identity = 33/71 (46.48%), Postives = 49/71 (69.01%), Query Frame = 1
Query:  115 LAKPKDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +A+ +DYY +L V  DA+++EI+  Y +L+ K+HPD  K  D A ++F+E+ EAY+ LSDP KR  YD  G
Sbjct:    1 MAEKRDYYDVLGVGRDASDDEIKKAYRKLSKKYHPDINKAPD-AEAKFKEVTEAYEALSDPQKRAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_GLUDA (Chaperone protein dnaJ OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 9.229e-12
Identity = 33/71 (46.48%), Postives = 45/71 (63.38%), Query Frame = 1
Query:  115 LAKPKDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +A   DYY +LEV  DA  +E++  Y RLA+++HPD+      A +RF+EINEAY +L D  KR  YD  G
Sbjct:    1 MATKLDYYAVLEVTRDANGDELKKAYRRLAMQYHPDRNPGDASAEARFKEINEAYDILKDEQKRAAYDRFG 71          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_GEOSW (Chaperone protein dnaJ OS=Geobacillus sp. (strain WCH70) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 9.229e-12
Identity = 35/67 (52.24%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY+IL V  +AT+EEI+  Y +L+ K+HPD  K+ D A  +F+EI EAY+VLSD  KR  YD  G
Sbjct:    4 RDYYEILGVSKNATKEEIKKAYRKLSKKYHPDINKEPD-AAEKFKEIKEAYEVLSDDQKRAHYDQFG 69          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_CUPTR (Chaperone protein dnaJ OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 9.229e-12
Identity = 30/67 (44.78%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY++L V  +A+++EI+  Y +LA+K+HPD+  D   A  +F+E  EAY++LSDP K+  YD  G
Sbjct:    4 RDYYEVLGVGKNASDDEIKKAYRKLAMKFHPDRNPDSKDAEEKFKEAKEAYEMLSDPEKKAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_BACTR (Chaperone protein dnaJ OS=Bacillus thermoglucosidasius GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 9.229e-12
Identity = 35/67 (52.24%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY+IL V  +AT+EEI+  Y +L+ K+HPD  K+ D A  +F+EI EAY+VLSD  KR  YD  G
Sbjct:    4 RDYYEILGVSKNATKEEIKKAYRKLSKKYHPDINKEPD-AAEKFKEIKEAYEVLSDDQKRAHYDQFG 69          
The following BLAST results are available for this feature:
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 356
Match NameE-valueIdentityDescription
DNAJ_LEPIN9.229e-1247.76Chaperone protein dnaJ OS=Leptospira interrogans G... [more]
DNAJ_LEPIC9.229e-1247.76Chaperone protein dnaJ OS=Leptospira interrogans s... [more]
DNAJ_LEPBL9.229e-1247.76Chaperone protein dnaJ OS=Leptospira borgpeterseni... [more]
DNAJ_LEPBJ9.229e-1247.76Chaperone protein dnaJ OS=Leptospira borgpeterseni... [more]
DNAJ_LACSS9.229e-1246.48Chaperone protein dnaJ OS=Lactobacillus sakei subs... [more]
DNAJ_LACSK9.229e-1246.48Chaperone protein dnaJ OS=Lactobacillus sakei GN=d... [more]
DNAJ_GLUDA9.229e-1246.48Chaperone protein dnaJ OS=Gluconacetobacter diazot... [more]
DNAJ_GEOSW9.229e-1252.24Chaperone protein dnaJ OS=Geobacillus sp. (strain ... [more]
DNAJ_CUPTR9.229e-1244.78Chaperone protein dnaJ OS=Cupriavidus taiwanensis ... [more]
DNAJ_BACTR9.229e-1252.24Chaperone protein dnaJ OS=Bacillus thermoglucosida... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00282 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00282 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623191 ID=BQ623191|Name=BQ623191|organism=Citrus sinensis|type=EST|length=520bp
GTTTGTGTCCCCTCTACTAAAGAGGTCATGATGTGGGACGAATGGGTCGA
TTGCAACAATAACGATGAACAAACCCAACAGGATTCCCATGTCAATTTTG
ATTTTCTTTCTCTTCTCGCCAAACCCAAGGATTATTATAAAATATTGGAA
GTTGATTACGATGCCACGGAGGAAGAAATTAGGTCCAATTACATTCGTCT
AGCGCTGAAATGGCACCCAGATAAGCAAAAGGATCGAGATTGTGCAACTT
CGAGATTTCAAGAGATAAACGAGGCTTACCAGGTTTTGAGCGATCCTGTC
AAAAGGAGAGAATATGACAGCAAAGGGATGTTGCACATATATGATCGCAA
CATAATTGAGTATCTTAATCGCTACAAGGGCTTAATATTAACTTGCAATG
GTCTTGGGATGAGGCATTCAATTGTGTAATATGTTGTCAGCACAGTTGGG
GCAGTTCATATTGGGAGGCATAGAATTACCAATGCTGCAAATAGCATTGA
GGGCATGGAGAATAGCAGTT
back to top