BQ623191

Overview
NameBQ623191
Unique NameBQ623191
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length520
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig383 contig Csv1_Contig383:27..546. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_AZOC5 (Chaperone protein dnaJ OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / ORS 571) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 9.229e-12
Identity = 32/67 (47.76%), Postives = 45/67 (67.16%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY++L  D  A E  +++++ +LA+KWHPDK      A  RF+EI+EAY+VL DP KR  YD  G
Sbjct:    4 RDYYEVLGCDRGADETVLKASFRKLAMKWHPDKNPGDPEAEIRFKEISEAYEVLKDPQKRGAYDRYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_ANAMM (Chaperone protein dnaJ OS=Anaplasma marginale (strain St. Maries) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 9.229e-12
Identity = 32/66 (48.48%), Postives = 46/66 (69.70%), Query Frame = 1
Query:  130 DYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            DYY+ILEV  +A+ EEI+ +Y ++  K+HPDK      A  +F++I+EAY+VLS+P KR  YD  G
Sbjct:    5 DYYEILEVSRNASAEEIKKSYRKMVFKYHPDKNPGDKKAEEKFKKISEAYEVLSNPEKRAAYDRYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_ANAMF (Chaperone protein dnaJ OS=Anaplasma marginale (strain Florida) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 9.229e-12
Identity = 32/66 (48.48%), Postives = 46/66 (69.70%), Query Frame = 1
Query:  130 DYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            DYY+ILEV  +A+ EEI+ +Y ++  K+HPDK      A  +F++I+EAY+VLS+P KR  YD  G
Sbjct:    5 DYYEILEVSRNASAEEIKKSYRKMVFKYHPDKNPGDKKAEEKFKKISEAYEVLSNPEKRAAYDRYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ1_STRAW (Chaperone protein dnaJ 1 OS=Streptomyces avermitilis GN=dnaJ1 PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 9.229e-12
Identity = 34/64 (53.12%), Postives = 43/64 (67.19%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYD 318
            KDYYK+L V  DATE EI+  Y +LA ++HPD  K    A  RF+EI+EA  +L D  KR+EYD
Sbjct:    9 KDYYKVLGVPKDATEAEIKKAYRKLAREFHPDANKGNAKAEERFKEISEANDILGDTKKRKEYD 72          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: CBPA_PSEPW (Curved DNA-binding protein OS=Pseudomonas putida (strain W619) GN=cbpA PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 9.229e-12
Identity = 35/64 (54.69%), Postives = 46/64 (71.88%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYD 318
            KDYYKIL V+  A E+ I++ Y +LA K+HPD  K+RD A  +F+E NEAY+VL D  KR E+D
Sbjct:    4 KDYYKILGVEPTADEKAIKAAYRKLARKYHPDVSKERD-AEEKFKEANEAYEVLGDAQKRAEFD 66          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: CBPA_PSEPK (Curved DNA-binding protein OS=Pseudomonas putida (strain KT2440) GN=cbpA PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 9.229e-12
Identity = 35/64 (54.69%), Postives = 46/64 (71.88%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYD 318
            KDYYKIL V+  A E+ I++ Y +LA K+HPD  K+RD A  +F+E NEAY+VL D  KR E+D
Sbjct:    4 KDYYKILGVEPTADEKAIKAAYRKLARKYHPDVSKERD-AEEKFKEANEAYEVLGDAQKRAEFD 66          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: CBPA_PSEP1 (Curved DNA-binding protein OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=cbpA PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 9.229e-12
Identity = 35/64 (54.69%), Postives = 46/64 (71.88%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYD 318
            KDYYKIL V+  A E+ I++ Y +LA K+HPD  K+RD A  +F+E NEAY+VL D  KR E+D
Sbjct:    4 KDYYKILGVEPTADEKAIKAAYRKLARKYHPDVSKERD-AEEKFKEANEAYEVLGDAQKRAEFD 66          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_YERP3 (Chaperone protein dnaJ OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.205e-11
Identity = 31/67 (46.27%), Postives = 45/67 (67.16%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY++L V  DA E EI+  Y RLA+K+HPD++ +   A  +F+E  EAY++L+D  KR  YD  G
Sbjct:    4 RDYYEVLGVSRDAEEREIKKAYKRLAMKFHPDRKSEDKNAEEKFKEAKEAYEILTDAQKRAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_VIBPA (Chaperone protein dnaJ OS=Vibrio parahaemolyticus GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.205e-11
Identity = 29/67 (43.28%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +D+Y++L V  DA+E +I+  Y RLA+K+HPD+ +  + A  +F+E+ EAY+VL+D  K+  YD  G
Sbjct:    4 RDFYEVLGVSRDASERDIKKAYKRLAMKFHPDRNQGDESAADKFKEVKEAYEVLTDSQKKAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_SHIFL (Chaperone protein dnaJ OS=Shigella flexneri GN=dnaJ PE=2 SV=3)

HSP 1 Score: 69.3218 bits (168), Expect = 1.205e-11
Identity = 34/67 (50.75%), Postives = 45/67 (67.16%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY+IL V   A E EIR  Y RLA+K+HPD+ +    A ++F+EI EAY+VL+D  KR  YD  G
Sbjct:    4 QDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYG 70          
The following BLAST results are available for this feature:
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 356
Match NameE-valueIdentityDescription
DNAJ_AZOC59.229e-1247.76Chaperone protein dnaJ OS=Azorhizobium caulinodans... [more]
DNAJ_ANAMM9.229e-1248.48Chaperone protein dnaJ OS=Anaplasma marginale (str... [more]
DNAJ_ANAMF9.229e-1248.48Chaperone protein dnaJ OS=Anaplasma marginale (str... [more]
DNAJ1_STRAW9.229e-1253.13Chaperone protein dnaJ 1 OS=Streptomyces avermitil... [more]
CBPA_PSEPW9.229e-1254.69Curved DNA-binding protein OS=Pseudomonas putida (... [more]
CBPA_PSEPK9.229e-1254.69Curved DNA-binding protein OS=Pseudomonas putida (... [more]
CBPA_PSEP19.229e-1254.69Curved DNA-binding protein OS=Pseudomonas putida (... [more]
DNAJ_YERP31.205e-1146.27Chaperone protein dnaJ OS=Yersinia pseudotuberculo... [more]
DNAJ_VIBPA1.205e-1143.28Chaperone protein dnaJ OS=Vibrio parahaemolyticus ... [more]
DNAJ_SHIFL1.205e-1150.75Chaperone protein dnaJ OS=Shigella flexneri GN=dna... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00282 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00282 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623191 ID=BQ623191|Name=BQ623191|organism=Citrus sinensis|type=EST|length=520bp
GTTTGTGTCCCCTCTACTAAAGAGGTCATGATGTGGGACGAATGGGTCGA
TTGCAACAATAACGATGAACAAACCCAACAGGATTCCCATGTCAATTTTG
ATTTTCTTTCTCTTCTCGCCAAACCCAAGGATTATTATAAAATATTGGAA
GTTGATTACGATGCCACGGAGGAAGAAATTAGGTCCAATTACATTCGTCT
AGCGCTGAAATGGCACCCAGATAAGCAAAAGGATCGAGATTGTGCAACTT
CGAGATTTCAAGAGATAAACGAGGCTTACCAGGTTTTGAGCGATCCTGTC
AAAAGGAGAGAATATGACAGCAAAGGGATGTTGCACATATATGATCGCAA
CATAATTGAGTATCTTAATCGCTACAAGGGCTTAATATTAACTTGCAATG
GTCTTGGGATGAGGCATTCAATTGTGTAATATGTTGTCAGCACAGTTGGG
GCAGTTCATATTGGGAGGCATAGAATTACCAATGCTGCAAATAGCATTGA
GGGCATGGAGAATAGCAGTT
back to top