BQ623191

Overview
NameBQ623191
Unique NameBQ623191
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length520
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig383 contig Csv1_Contig383:27..546. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_CLOK5 (Chaperone protein dnaJ OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 3.747e-13
Identity = 33/67 (49.25%), Postives = 50/67 (74.63%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            KDYY+IL +D  A++++I+  + +LALK+HPD+  +   A  +F+EINEAYQVL+DP K+ +YD  G
Sbjct:    4 KDYYEILGLDKGASDQDIKKAFRKLALKYHPDRNPNDKKAEEKFKEINEAYQVLTDPQKKAQYDQFG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_CLOAB (Chaperone protein dnaJ OS=Clostridium acetobutylicum GN=dnaJ PE=2 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 3.747e-13
Identity = 33/67 (49.25%), Postives = 49/67 (73.13%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            KDYY++L ++  A+++EI+  + +LA+K+HPDK +    A  +F+EINEAYQVLSDP K+  YD  G
Sbjct:    4 KDYYEVLGLEKGASDDEIKKAFRKLAIKYHPDKNRGNKEAEEKFKEINEAYQVLSDPDKKANYDRFG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_ACIF5 (Chaperone protein dnaJ OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 3.747e-13
Identity = 33/67 (49.25%), Postives = 48/67 (71.64%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY++LE+   A + EI+ +Y RLA+++HPD+  D   A  RF+EI+ AY+VLSDP KR+ YD  G
Sbjct:    4 RDYYEVLEISRTADDGEIKKSYRRLAMRYHPDRNPDDASAEERFKEISAAYEVLSDPQKRQAYDRFG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_ACIF2 (Chaperone protein dnaJ OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / NCIB 8455) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 3.747e-13
Identity = 33/67 (49.25%), Postives = 48/67 (71.64%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY++LE+   A + EI+ +Y RLA+++HPD+  D   A  RF+EI+ AY+VLSDP KR+ YD  G
Sbjct:    4 RDYYEVLEISRTADDGEIKKSYRRLAMRYHPDRNPDDASAEERFKEISAAYEVLSDPQKRQAYDRFG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ2_AQUAE (Chaperone protein dnaJ 2 OS=Aquifex aeolicus GN=dnaJ2 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 3.747e-13
Identity = 38/67 (56.72%), Postives = 48/67 (71.64%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            KDYY+IL V  +A++EEI+  Y RL  K+HPD  K  +C   +F+EINEAYQVLSDP KR+ YD  G
Sbjct:    7 KDYYEILGVPRNASQEEIKKAYRRLVRKYHPDICKKPEC-EEKFKEINEAYQVLSDPEKRKLYDMYG 72          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: TID_DROVI (Protein tumorous imaginal discs, mitochondrial OS=Drosophila virilis GN=l(2)tid PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 4.893e-13
Identity = 39/101 (38.61%), Postives = 57/101 (56.44%), Query Frame = 1
Query:   25 VMMWDEWVDCNNNDEQTQQDSHVNFDFLSLLAKPKDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            V  W +      + +Q ++       F S   + KDYY  L V  +A  ++I+  Y  LA K+HPD  KD   A+ +FQ+++EAY+VLSD  KRREYD+ G
Sbjct:   50 VSAWQQRTTAKQHQQQQRRSL-----FSSSRMQAKDYYATLGVAKNANAKDIKKAYYELAKKYHPDTNKDDPDASKKFQDVSEAYEVLSDDQKRREYDTYG 145          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_YERE8 (Chaperone protein dnaJ OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 4.893e-13
Identity = 32/67 (47.76%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY++L V  DA E EI+  Y RLA+K+HPD+ +D +     F+E+ EAY++L+DP KR  YD  G
Sbjct:    4 RDYYEVLGVKKDADEREIKKAYKRLAVKYHPDRNQDENDTGENFKEVKEAYEILTDPQKRAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_THETN (Chaperone protein dnaJ OS=Thermoanaerobacter tengcongensis GN=dnaJ PE=3 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 4.893e-13
Identity = 36/67 (53.73%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            KD Y+IL VD +A++EEI+  Y RLA K+HPD       A  +F+EINEAY++LSDP KR +YD  G
Sbjct:    4 KDLYEILGVDRNASQEEIKKAYRRLAKKYHPDLNPGDKEAEQKFKEINEAYEILSDPQKRAQYDQFG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_PROA2 (Chaperone protein dnaJ OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 4.893e-13
Identity = 34/67 (50.75%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY++L V   AT++EI+  Y +LA+K+HPDK  D   A  +F+E NEAY+VLS+  KRR YD  G
Sbjct:    3 RDYYEVLGVGRSATKDEIKKAYRKLAMKYHPDKNPDNSEAEEKFKEANEAYEVLSNDDKRRRYDQFG 69          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_CHLL2 (Chaperone protein dnaJ OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 4.893e-13
Identity = 34/67 (50.75%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            KDYY++L V   A+++EI+  Y +LAL++HPDK  D   A   F+E+NEAY+VLS+  KRR YD  G
Sbjct:    3 KDYYEVLGVSRSASKDEIKKAYRKLALQYHPDKNPDNKDAEEHFKEVNEAYEVLSNDDKRRRYDQFG 69          
The following BLAST results are available for this feature:
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 356
Match NameE-valueIdentityDescription
DNAJ_CLOK53.747e-1349.25Chaperone protein dnaJ OS=Clostridium kluyveri (st... [more]
DNAJ_CLOAB3.747e-1349.25Chaperone protein dnaJ OS=Clostridium acetobutylic... [more]
DNAJ_ACIF53.747e-1349.25Chaperone protein dnaJ OS=Acidithiobacillus ferroo... [more]
DNAJ_ACIF23.747e-1349.25Chaperone protein dnaJ OS=Acidithiobacillus ferroo... [more]
DNAJ2_AQUAE3.747e-1356.72Chaperone protein dnaJ 2 OS=Aquifex aeolicus GN=dn... [more]
TID_DROVI4.893e-1338.61Protein tumorous imaginal discs, mitochondrial OS=... [more]
DNAJ_YERE84.893e-1347.76Chaperone protein dnaJ OS=Yersinia enterocolitica ... [more]
DNAJ_THETN4.893e-1353.73Chaperone protein dnaJ OS=Thermoanaerobacter tengc... [more]
DNAJ_PROA24.893e-1350.75Chaperone protein dnaJ OS=Prosthecochloris aestuar... [more]
DNAJ_CHLL24.893e-1350.75Chaperone protein dnaJ OS=Chlorobium limicola (str... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00282 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00282 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623191 ID=BQ623191|Name=BQ623191|organism=Citrus sinensis|type=EST|length=520bp
GTTTGTGTCCCCTCTACTAAAGAGGTCATGATGTGGGACGAATGGGTCGA
TTGCAACAATAACGATGAACAAACCCAACAGGATTCCCATGTCAATTTTG
ATTTTCTTTCTCTTCTCGCCAAACCCAAGGATTATTATAAAATATTGGAA
GTTGATTACGATGCCACGGAGGAAGAAATTAGGTCCAATTACATTCGTCT
AGCGCTGAAATGGCACCCAGATAAGCAAAAGGATCGAGATTGTGCAACTT
CGAGATTTCAAGAGATAAACGAGGCTTACCAGGTTTTGAGCGATCCTGTC
AAAAGGAGAGAATATGACAGCAAAGGGATGTTGCACATATATGATCGCAA
CATAATTGAGTATCTTAATCGCTACAAGGGCTTAATATTAACTTGCAATG
GTCTTGGGATGAGGCATTCAATTGTGTAATATGTTGTCAGCACAGTTGGG
GCAGTTCATATTGGGAGGCATAGAATTACCAATGCTGCAAATAGCATTGA
GGGCATGGAGAATAGCAGTT
back to top