BQ623191

Overview
NameBQ623191
Unique NameBQ623191
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length520
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig383 contig Csv1_Contig383:27..546. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_CLOTH (Chaperone protein dnaJ OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 8.347e-13
Identity = 35/71 (49.30%), Postives = 48/71 (67.61%), Query Frame = 1
Query:  115 LAKPKDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +A  +DYY+IL VD  A++ EI+  Y +LA ++HPD       A ++F+EINEAY+VLSDP KR  YD  G
Sbjct:    1 MAGKRDYYEILGVDRGASDAEIKKAYRKLAKQYHPDMNPGDKAAEAKFKEINEAYEVLSDPQKRARYDQFG 71          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_CLONN (Chaperone protein dnaJ OS=Clostridium novyi (strain NT) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 8.347e-13
Identity = 32/67 (47.76%), Postives = 48/67 (71.64%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            KDYY++L +   A+++EI+  Y +LA+K+HPD+ +    A  +F++INEAYQVLSDP K+  YD  G
Sbjct:    4 KDYYEVLGLSKGASDDEIKKAYRKLAMKYHPDRNQGNKEAEEKFKDINEAYQVLSDPQKKANYDQFG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNJA3_HUMAN (DnaJ homolog subfamily A member 3, mitochondrial OS=Homo sapiens GN=DNAJA3 PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.090e-12
Identity = 36/71 (50.70%), Postives = 52/71 (73.24%), Query Frame = 1
Query:  115 LAKPKDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            LAK +DYY+IL V  +A+++EI+  Y +LA K+HPD  KD   A  +F ++ EAY+VLSD VKR++YD+ G
Sbjct:   89 LAK-EDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYDAYG 158          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_CHLP8 (Chaperone protein dnaJ OS=Chlorobaculum parvum (strain NCIB 8327) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.090e-12
Identity = 35/67 (52.24%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY+IL V   A ++EI+  Y +LALK+HPDK  D   A  +F+E NEAY+VLS+  KRR YD  G
Sbjct:    3 RDYYEILGVSRSADKDEIKKAYRKLALKYHPDKNPDNKEAEEKFKEANEAYEVLSNDDKRRRYDQFG 69          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_BLOFL (Chaperone protein dnaJ OS=Blochmannia floridanus GN=dnaJ PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.090e-12
Identity = 37/74 (50.00%), Postives = 51/74 (68.92%), Query Frame = 1
Query:  130 DYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKGMLHIYDRN 351
            DYY+IL V  +A E EI+ +Y RLA+K+HPD+      A S+F+EI EAY+VLS+P KR  YD  G   I+++N
Sbjct:    5 DYYEILGVSKNADEREIKKSYKRLAMKFHPDRNPGDVSAESKFKEIKEAYEVLSNPEKRSAYDQYGHA-IFEQN 77          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_AZOVD (Chaperone protein dnaJ OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.090e-12
Identity = 33/67 (49.25%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY++L V+  A E E++  Y RLA+K+HPD+  D   A  +F+E+NEAY+VLSD  KR  YD  G
Sbjct:    4 RDYYEVLGVERGAGEAELKKAYRRLAMKYHPDRNPDDKSAEEKFKEVNEAYEVLSDAGKRMAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_GEOSL (Chaperone protein dnaJ OS=Geobacter sulfurreducens GN=dnaJ PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.424e-12
Identity = 33/72 (45.83%), Postives = 50/72 (69.44%), Query Frame = 1
Query:  112 LLAKPKDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            + A  +DYY++L V  +A++ EI+  + +LA+++HPDK  D   A  +F+EI EAY+VLSDP KR +YD  G
Sbjct:    1 MAADKRDYYEVLGVHKNASDTEIKKAFRKLAIQYHPDKNPDDKEAEEKFKEITEAYEVLSDPQKRAQYDQFG 72          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_VIBVY (Chaperone protein dnaJ OS=Vibrio vulnificus (strain YJ016) GN=dnaJ PE=3 SV=2)

HSP 1 Score: 72.0182 bits (175), Expect = 1.860e-12
Identity = 29/67 (43.28%), Postives = 48/67 (71.64%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +D+Y++L V  DA+E +I+  Y RLA+K+HPD+ +  + A  +F+E+ EAY++L+DP K+  YD  G
Sbjct:    4 RDFYEVLGVSRDASERDIKKAYKRLAMKFHPDRNQGDESAADKFKEVKEAYEILTDPQKKAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_VIBVU (Chaperone protein dnaJ OS=Vibrio vulnificus GN=dnaJ PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.860e-12
Identity = 29/67 (43.28%), Postives = 48/67 (71.64%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +D+Y++L V  DA+E +I+  Y RLA+K+HPD+ +  + A  +F+E+ EAY++L+DP K+  YD  G
Sbjct:    4 RDFYEVLGVSRDASERDIKKAYKRLAMKFHPDRNQGDESAADKFKEVKEAYEILTDPQKKAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_SERP5 (Chaperone protein dnaJ OS=Serratia proteamaculans (strain 568) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.860e-12
Identity = 35/67 (52.24%), Postives = 48/67 (71.64%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            KDYY+IL V   A E EI+  Y RLA+K+HPD+ +++D A +RF+EI EAY++L+D  KR  YD  G
Sbjct:    4 KDYYEILGVSKTAEEREIKKAYKRLAMKFHPDRNQEQD-AEARFKEIKEAYEILTDAQKRAAYDQYG 69          
The following BLAST results are available for this feature:
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 356
Match NameE-valueIdentityDescription
DNAJ_CLOTH8.347e-1349.30Chaperone protein dnaJ OS=Clostridium thermocellum... [more]
DNAJ_CLONN8.347e-1347.76Chaperone protein dnaJ OS=Clostridium novyi (strai... [more]
DNJA3_HUMAN1.090e-1250.70DnaJ homolog subfamily A member 3, mitochondrial O... [more]
DNAJ_CHLP81.090e-1252.24Chaperone protein dnaJ OS=Chlorobaculum parvum (st... [more]
DNAJ_BLOFL1.090e-1250.00Chaperone protein dnaJ OS=Blochmannia floridanus G... [more]
DNAJ_AZOVD1.090e-1249.25Chaperone protein dnaJ OS=Azotobacter vinelandii (... [more]
DNAJ_GEOSL1.424e-1245.83Chaperone protein dnaJ OS=Geobacter sulfurreducens... [more]
DNAJ_VIBVY1.860e-1243.28Chaperone protein dnaJ OS=Vibrio vulnificus (strai... [more]
DNAJ_VIBVU1.860e-1243.28Chaperone protein dnaJ OS=Vibrio vulnificus GN=dna... [more]
DNAJ_SERP51.860e-1252.24Chaperone protein dnaJ OS=Serratia proteamaculans ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00282 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00282 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623191 ID=BQ623191|Name=BQ623191|organism=Citrus sinensis|type=EST|length=520bp
GTTTGTGTCCCCTCTACTAAAGAGGTCATGATGTGGGACGAATGGGTCGA
TTGCAACAATAACGATGAACAAACCCAACAGGATTCCCATGTCAATTTTG
ATTTTCTTTCTCTTCTCGCCAAACCCAAGGATTATTATAAAATATTGGAA
GTTGATTACGATGCCACGGAGGAAGAAATTAGGTCCAATTACATTCGTCT
AGCGCTGAAATGGCACCCAGATAAGCAAAAGGATCGAGATTGTGCAACTT
CGAGATTTCAAGAGATAAACGAGGCTTACCAGGTTTTGAGCGATCCTGTC
AAAAGGAGAGAATATGACAGCAAAGGGATGTTGCACATATATGATCGCAA
CATAATTGAGTATCTTAATCGCTACAAGGGCTTAATATTAACTTGCAATG
GTCTTGGGATGAGGCATTCAATTGTGTAATATGTTGTCAGCACAGTTGGG
GCAGTTCATATTGGGAGGCATAGAATTACCAATGCTGCAAATAGCATTGA
GGGCATGGAGAATAGCAGTT
back to top