BQ623191

Overview
NameBQ623191
Unique NameBQ623191
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length520
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig383 contig Csv1_Contig383:27..546. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_YERPY (Chaperone protein dnaJ OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 4.143e-12
Identity = 32/67 (47.76%), Postives = 45/67 (67.16%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY++L V  DA E EI+  Y RLA+K+HPD+Q +   A  +F+E  EAY++L+D  KR  YD  G
Sbjct:    4 RDYYEVLGVSRDAEEREIKKAYKRLAMKFHPDRQSEDKNAEEKFKEAKEAYEILTDAQKRAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_YERPS (Chaperone protein dnaJ OS=Yersinia pseudotuberculosis GN=dnaJ PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 4.143e-12
Identity = 32/67 (47.76%), Postives = 45/67 (67.16%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY++L V  DA E EI+  Y RLA+K+HPD+Q +   A  +F+E  EAY++L+D  KR  YD  G
Sbjct:    4 RDYYEVLGVSRDAEEREIKKAYKRLAMKFHPDRQSEDKNAEEKFKEAKEAYEILTDAQKRAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_YERPP (Chaperone protein dnaJ OS=Yersinia pestis (strain Pestoides F) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 4.143e-12
Identity = 32/67 (47.76%), Postives = 45/67 (67.16%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY++L V  DA E EI+  Y RLA+K+HPD+Q +   A  +F+E  EAY++L+D  KR  YD  G
Sbjct:    4 RDYYEVLGVSRDAEEREIKKAYKRLAMKFHPDRQSEDKNAEEKFKEAKEAYEILTDAQKRAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_YERPN (Chaperone protein dnaJ OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 4.143e-12
Identity = 32/67 (47.76%), Postives = 45/67 (67.16%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY++L V  DA E EI+  Y RLA+K+HPD+Q +   A  +F+E  EAY++L+D  KR  YD  G
Sbjct:    4 RDYYEVLGVSRDAEEREIKKAYKRLAMKFHPDRQSEDKNAEEKFKEAKEAYEILTDAQKRAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_YERPG (Chaperone protein dnaJ OS=Yersinia pestis bv. Antiqua (strain Angola) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 4.143e-12
Identity = 32/67 (47.76%), Postives = 45/67 (67.16%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY++L V  DA E EI+  Y RLA+K+HPD+Q +   A  +F+E  EAY++L+D  KR  YD  G
Sbjct:    4 RDYYEVLGVSRDAEEREIKKAYKRLAMKFHPDRQSEDKNAEEKFKEAKEAYEILTDAQKRAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_YERPE (Chaperone protein dnaJ OS=Yersinia pestis GN=dnaJ PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 4.143e-12
Identity = 32/67 (47.76%), Postives = 45/67 (67.16%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY++L V  DA E EI+  Y RLA+K+HPD+Q +   A  +F+E  EAY++L+D  KR  YD  G
Sbjct:    4 RDYYEVLGVSRDAEEREIKKAYKRLAMKFHPDRQSEDKNAEEKFKEAKEAYEILTDAQKRAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_YERPB (Chaperone protein dnaJ OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 4.143e-12
Identity = 32/67 (47.76%), Postives = 45/67 (67.16%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY++L V  DA E EI+  Y RLA+K+HPD+Q +   A  +F+E  EAY++L+D  KR  YD  G
Sbjct:    4 RDYYEVLGVSRDAEEREIKKAYKRLAMKFHPDRQSEDKNAEEKFKEAKEAYEILTDAQKRAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_YERPA (Chaperone protein dnaJ OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 4.143e-12
Identity = 32/67 (47.76%), Postives = 45/67 (67.16%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY++L V  DA E EI+  Y RLA+K+HPD+Q +   A  +F+E  EAY++L+D  KR  YD  G
Sbjct:    4 RDYYEVLGVSRDAEEREIKKAYKRLAMKFHPDRQSEDKNAEEKFKEAKEAYEILTDAQKRAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_PICTO (Chaperone protein dnaJ OS=Picrophilus torridus GN=dnaJ PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 4.143e-12
Identity = 33/67 (49.25%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            KDYY IL VD +A++++I+  +  LA K+HPD       A  +F+EI EAY+VLSDP KR++YD  G
Sbjct:    3 KDYYAILGVDRNASQDDIKKAFRELAKKYHPDANPGNKEAEEKFKEIAEAYEVLSDPQKRKQYDETG 69          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_ACTSZ (Chaperone protein dnaJ OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 4.143e-12
Identity = 33/67 (49.25%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY+IL V+  A E+ I+  Y RLA+K+HPD+ K    +  +F+EINEAY++LSD  KR  YD  G
Sbjct:    4 QDYYEILGVERGADEKAIKKAYKRLAMKYHPDRTKGDKTSEEKFKEINEAYEILSDKEKRAAYDQYG 70          
The following BLAST results are available for this feature:
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 356
Match NameE-valueIdentityDescription
DNAJ_YERPY4.143e-1247.76Chaperone protein dnaJ OS=Yersinia pseudotuberculo... [more]
DNAJ_YERPS4.143e-1247.76Chaperone protein dnaJ OS=Yersinia pseudotuberculo... [more]
DNAJ_YERPP4.143e-1247.76Chaperone protein dnaJ OS=Yersinia pestis (strain ... [more]
DNAJ_YERPN4.143e-1247.76Chaperone protein dnaJ OS=Yersinia pestis bv. Anti... [more]
DNAJ_YERPG4.143e-1247.76Chaperone protein dnaJ OS=Yersinia pestis bv. Anti... [more]
DNAJ_YERPE4.143e-1247.76Chaperone protein dnaJ OS=Yersinia pestis GN=dnaJ ... [more]
DNAJ_YERPB4.143e-1247.76Chaperone protein dnaJ OS=Yersinia pseudotuberculo... [more]
DNAJ_YERPA4.143e-1247.76Chaperone protein dnaJ OS=Yersinia pestis bv. Anti... [more]
DNAJ_PICTO4.143e-1249.25Chaperone protein dnaJ OS=Picrophilus torridus GN=... [more]
DNAJ_ACTSZ4.143e-1249.25Chaperone protein dnaJ OS=Actinobacillus succinoge... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00282 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00282 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623191 ID=BQ623191|Name=BQ623191|organism=Citrus sinensis|type=EST|length=520bp
GTTTGTGTCCCCTCTACTAAAGAGGTCATGATGTGGGACGAATGGGTCGA
TTGCAACAATAACGATGAACAAACCCAACAGGATTCCCATGTCAATTTTG
ATTTTCTTTCTCTTCTCGCCAAACCCAAGGATTATTATAAAATATTGGAA
GTTGATTACGATGCCACGGAGGAAGAAATTAGGTCCAATTACATTCGTCT
AGCGCTGAAATGGCACCCAGATAAGCAAAAGGATCGAGATTGTGCAACTT
CGAGATTTCAAGAGATAAACGAGGCTTACCAGGTTTTGAGCGATCCTGTC
AAAAGGAGAGAATATGACAGCAAAGGGATGTTGCACATATATGATCGCAA
CATAATTGAGTATCTTAATCGCTACAAGGGCTTAATATTAACTTGCAATG
GTCTTGGGATGAGGCATTCAATTGTGTAATATGTTGTCAGCACAGTTGGG
GCAGTTCATATTGGGAGGCATAGAATTACCAATGCTGCAAATAGCATTGA
GGGCATGGAGAATAGCAGTT
back to top