BQ623340

Overview
NameBQ623340
Unique NameBQ623340
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length656
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig18 contig Csv1_Contig18:1..656. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623340 vs. ExPASy Swiss-Prot
Match: PGIP1_ARATH (Polygalacturonase inhibitor 1 OS=Arabidopsis thaliana GN=PGIP1 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.972e-11
Identity = 56/178 (31.46%), Postives = 83/178 (46.63%), Query Frame = 1
Query:    7 SFSSSVPDSLTQLKXXXXXXXXXXXXXXXXPKNTFLMSSLRRLDLSYNKLTGSLPK----LPPNLSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIP 528
            + +  +PD ++QLK                P +   +  +  L+LS NKLTGS+P+     P  + +L L +N LSG I K+   G      I+LS N   G     F        ++LS N + +  ISK VD    L  +DL  N I G +PV + + P L   ++ YN+L G IP
Sbjct:  130 NLTGPIPDFISQLKNLEFLELSFNDLSGSIPSSLSTLPKILALELSRNKLTGSIPESFGSFPGTVPDLRLSHNQLSGPIPKSL--GNIDFNRIDLSRNKLQGDASMLFGSNKTTWSIDLSRN-MFQFDISK-VDIPKTLGILDLNHNGITGNIPVQWTEAP-LQFFNVSYNKLCGHIP 302          
BLAST of BQ623340 vs. ExPASy Swiss-Prot
Match: Y2278_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At2g02780 OS=Arabidopsis thaliana GN=At2g02780 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.575e-11
Identity = 44/152 (28.95%), Postives = 73/152 (48.03%), Query Frame = 1
Query:    1 SNSFSSSVPDSLTQLKXXXXXXXXXXXXXXXXPKNTFLMSSLRRLDLSYNKLTGSLPKLPPNLSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLP 456
            SN  S  +P+ +  LK                  +   +S+L+ LDL  NKL   +P LP  L+ ++LKNN     I +     L  L+ ++LS N FTG++  + F +P+LQ ++L  N L+   +       S ++ +D+  N + G LP
Sbjct:  140 SNFISGKIPEEIVSLKNLKSLVLRDNMFWGFVSDDLRGLSNLQELDLGGNKLGPEVPSLPSKLTTVSLKNNSFRSKIPEQ-IKKLNNLQSLDLSSNEFTGSIPEFLFSIPSLQILSLDQNLLSG-SLPNSSCTSSKIITLDVSHNLLTGKLP 289          
BLAST of BQ623340 vs. ExPASy Swiss-Prot
Match: PGIP1_ORYSJ (Polygalacturonase inhibitor 1 OS=Oryza sativa subsp. japonica GN=FOR1 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.363e-11
Identity = 54/174 (31.03%), Postives = 83/174 (47.70%), Query Frame = 1
Query:   13 SSSVPDSLTQLKXXXXXXXXXXXXXXXXPKNTFLMSSLRRLDLSYNKLTGSLPK--LPPNLSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIP 528
            S  +PDSL +++                P +   + +LR LDL  NKLTG +P   +      L L  N L+G I ++  D   ++  ++LS N  TG     F     + +V+LS N L    +SK V    +L  +DL  N+I+G +P + A    L +L + YNRL G +P
Sbjct:  133 SGVIPDSLARIRSLDSVDLSHNSLTGPIPNSFSDLPNLRSLDLRSNKLTGCIPAGLVQGQFRSLILSYNQLTGPIPRD--DAQDEINTVDLSHNRLTGDASFLFAAGRPIGKVDLSWNDLD-FDLSKLVFP-PELTYLDLSHNRIRGTVPRSLAALSTLQTLDLSYNRLCGPLP 302          
BLAST of BQ623340 vs. ExPASy Swiss-Prot
Match: IKU2_ARATH (Receptor-like protein kinase HAIKU2 OS=Arabidopsis thaliana GN=IKU2 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.363e-11
Identity = 51/171 (29.82%), Postives = 85/171 (49.71%), Query Frame = 1
Query:   97 PKNTFLMSSLRRLDLSYNKLTGSLPKLPPNL---SELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIG*AP 600
            P+    +++L+ + LS + +TG +P+   NL     L L +N +SG I K     L  L  +E+  N  TG L   F  L  L+  + SNN+L   G    +    +LV++ +  N++ G +P  F D+  L++LS+  N+L G +P       + K + +  NFL G  P
Sbjct:  190 PREILNLTALQWVYLSNSSITGKIPEGIKNLVRLQNLELSDNQISGEIPKEIVQ-LKNLRQLEIYSNDLTGKLPLGFRNLTNLRNFDASNNSLE--GDLSELRFLKNLVSLGMFENRLTGEIPKEFGDFKSLAALSLYRNQLTGKLPRRLGSWTAFKYIDVSENFLEGQIP 357          
BLAST of BQ623340 vs. ExPASy Swiss-Prot
Match: Y4265_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 4.392e-11
Identity = 49/171 (28.65%), Postives = 87/171 (50.88%), Query Frame = 1
Query:   97 PKNTFLMSSLRRLDLSYNKLTGSLPKLPPN---LSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIG*AP 600
            P++   + +L+ L LS N+++G++P+   N   L+ L + NN+++G I  +    L  L +    +N  TG +         LQ ++LS N+L+   I K + G  +L  + L  N + G++P +  +   L  L +  NRL G IP E  + K+L  + +  N L+G  P
Sbjct:  327 PRSFGKLENLQELQLSVNQISGTIPEELTNCTKLTHLEIDNNLITGEIP-SLMSNLRSLTMFFAWQNKLTGNIPQSLSQCRELQAIDLSYNSLSG-SIPKEIFGLRNLTKLLLLSNDLSGFIPPDIGNCTNLYRLRLNGNRLAGSIPSEIGNLKNLNFVDISENRLVGSIP 495          
BLAST of BQ623340 vs. ExPASy Swiss-Prot
Match: ERECT_ARATH (LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 4.392e-11
Identity = 55/174 (31.61%), Postives = 90/174 (51.72%), Query Frame = 1
Query:  112 LMSSLRRLDLSYNKLTGSLPKLPPNLS---ELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIG*APIGFFSGDL 624
            LM +L  LDLS N L+GS+P +  NL+   +L L +N L+G I       +++L  +EL++N  TG +      L  L  +N++NN L    I   +   ++L ++++  NK  G +P  F     ++ L++  N ++G IP+E S   +L  L L  N + G  P     GDL
Sbjct:  281 LMQALAVLDLSGNLLSGSIPPILGNLTFTEKLYLHSNKLTGSIPP-ELGNMSKLHYLELNDNHLTGHIPPELGKLTDLFDLNVANNDL-EGPIPDHLSSCTNLNSLNVHGNKFSGTIPRAFQKLESMTYLNLSSNNIKGPIPVELSRIGNLDTLDLSNNKINGIIPSSL--GDL 450          

HSP 2 Score: 67.781 bits (164), Expect = 5.737e-11
Identity = 52/165 (31.52%), Postives = 82/165 (49.70%), Query Frame = 1
Query:  118 SSLRRLDLSYNKLTGSLP----KLPPNLSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIG*AP 600
            SSL+ LDLS+N+L+G +P    KL   L +L LKNN L G I  ++   +  L++++L++N  +G +    +    LQ + L  N L    IS  +   + L   D+  N + G +P    +      L + YN+L G IP +    + +  L L GN L G  P
Sbjct:  116 SSLQNLDLSFNELSGDIPFSISKL-KQLEQLILKNNQLIGPI-PSTLSQIPNLKILDLAQNKLSGEIPRLIYWNEVLQYLGLRGNNLVG-NISPDLCQLTGLWYFDVRNNSLTGSIPETIGNCTAFQVLDLSYNQLTGEIPFDIGFLQ-VATLSLQGNQLSGKIP 276          
BLAST of BQ623340 vs. ExPASy Swiss-Prot
Match: Y5020_ARATH (Probable inactive receptor kinase At5g10020 OS=Arabidopsis thaliana GN=At5g10020 PE=1 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 5.737e-11
Identity = 46/146 (31.51%), Postives = 74/146 (50.68%), Query Frame = 1
Query:  118 SSLRRLDLSYNKLTGSLPKLPPNLSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSL 555
            S+L  L+LS N L+G LP    + S + L  N  SG ++       T  +V++LS N+ +G+L  +      L  +++ NN+++  G    + G S    +DL  NK  G++PV+F  +  L SL++  N L G IP   S    L
Sbjct:  319 STLTMLNLSSNGLSGDLPSSFKSCSVIDLSGNTFSGDVSVVQKWEATP-DVLDLSSNNLSGSLPNFTSAFSRLSVLSIRNNSVS--GSLPSLWGDSQFSVIDLSSNKFSGFIPVSFFTFASLRSLNLSRNNLEGPIPFRGSRASEL 461          
BLAST of BQ623340 vs. ExPASy Swiss-Prot
Match: Y5694_ARATH (Probably inactive leucine-rich repeat receptor-like protein kinase At5g06940 OS=Arabidopsis thaliana GN=At5g06940 PE=3 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 7.492e-11
Identity = 58/188 (30.85%), Postives = 82/188 (43.62%), Query Frame = 1
Query:  115 MSSLRRLDLSYNKLTGSLPK---LPPNLSELALKNNVLSGV---------------ITKNSFDG--------LTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIG*AP 600
            + +L  LD+S NKL+GS P        L  L+L +N   G                +  N F G        L ++++I    N FTG +     L  AL+QV + NN+ +   I   +     L       N+  G LP NF D P+LS +++ +NRL G IP E  + K L  L L GN   G  P
Sbjct:  268 LKNLVSLDVSQNKLSGSFPSGICSGKRLINLSLHSNFFEGSLPNSIGECLSLERLQVQNNGFSGEFPVVLWKLPRIKIIRADNNRFTGQVPESVSLASALEQVEIVNNSFSGE-IPHGLGLVKSLYKFSASQNRFSGELPPNFCDSPVLSIVNISHNRLLGKIP-ELKNCKKLVSLSLAGNAFTGEIP 453          
BLAST of BQ623340 vs. ExPASy Swiss-Prot
Match: RPKL_ARATH (Receptor protein kinase-like protein At4g34220 OS=Arabidopsis thaliana GN=At4g34220 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 7.492e-11
Identity = 57/168 (33.93%), Postives = 84/168 (50.00%), Query Frame = 1
Query:  109 FLMSSLRRLDLSYNKLTGSLPKLPPNLSEL---ALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNT--------------------LTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFAD-YPMLSSLSMRYNRLRGGIPLEFS 540
            F +  LR LDLS N   GSLP    N +EL   +L +N LSG + K S + +T L+++ LS N+FTG +     LL  L  V+LS NT                    L    + K + G+S L  ++L  NK+ G +  NFA+ +P  +++ + +N L G IP   S
Sbjct:  100 FSIPYLRILDLSSNFFNGSLPDSVFNATELQSISLGSNNLSGDLPK-SVNSVTNLQLLNLSANAFTGEIPLNISLLKNLTVVSLSKNTFSGDIPSGFEAAQILDLSSNLLNGSLPKDLGGKS-LHYLNLSHNKVLGEISPNFAEKFPANATVDLSFNNLTGPIPSSLS 265          
BLAST of BQ623340 vs. ExPASy Swiss-Prot
Match: BRL1_ARATH (Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 7.492e-11
Identity = 48/168 (28.57%), Postives = 82/168 (48.81%), Query Frame = 1
Query:  124 LRRLDLSYNKLTGSLPKLP-----PNLSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKS---LKRLFLDGNFLIG*API 603
            L  L++S N L G +P         NL +L+L +N LSG I          L +++LS N+F+G L + F     LQ +NL NN L+   ++  V   + +  + + +N I G +P++  +   L  L +  N   G +P  F   +S   L+++ +  N+L G  P+
Sbjct:  253 LETLNISRNNLAGKIPNGEYWGSFQNLKQLSLAHNRLSGEIPPELSLLCKTLVILDLSGNTFSGELPSQFTACVWLQNLNLGNNYLSGDFLNTVVSKITGITYLYVAYNNISGSVPISLTNCSNLRVLDLSSNGFTGNVPSGFCSLQSSPVLEKILIANNYLSGTVPM 420          
The following BLAST results are available for this feature:
BLAST of BQ623340 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 41
Match NameE-valueIdentityDescription
PGIP1_ARATH1.972e-1131.46Polygalacturonase inhibitor 1 OS=Arabidopsis thali... [more]
Y2278_ARATH2.575e-1128.95Probable LRR receptor-like serine/threonine-protei... [more]
PGIP1_ORYSJ3.363e-1131.03Polygalacturonase inhibitor 1 OS=Oryza sativa subs... [more]
IKU2_ARATH3.363e-1129.82Receptor-like protein kinase HAIKU2 OS=Arabidopsis... [more]
Y4265_ARATH4.392e-1128.65Probable LRR receptor-like serine/threonine-protei... [more]
ERECT_ARATH4.392e-1131.61LRR receptor-like serine/threonine-protein kinase ... [more]
Y5020_ARATH5.737e-1131.51Probable inactive receptor kinase At5g10020 OS=Ara... [more]
Y5694_ARATH7.492e-1130.85Probably inactive leucine-rich repeat receptor-lik... [more]
RPKL_ARATH7.492e-1133.93Receptor protein kinase-like protein At4g34220 OS=... [more]
BRL1_ARATH7.492e-1128.57Serine/threonine-protein kinase BRI1-like 1 OS=Ara... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00431 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00431 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623340 ID=BQ623340|Name=BQ623340|organism=Citrus sinensis|type=EST|length=656bp
TCCAACTCGTTCTCCAGCTCAGTCCCCGACTCACTCACCCAGCTCAAAAA
TCTCGATTCTTTAGACCTTTCTTATAATTCTCTATCCGGGTCTCTCCCAA
AAAACACATTTTTGATGTCGAGTTTGAGAAGACTCGATCTGAGTTACAAC
AAGCTCACCGGTTCATTACCAAAGCTGCCGCCAAATCTCTCAGAGCTAGC
TCTGAAGAACAATGTTTTATCTGGGGTTATTACAAAGAACTCCTTTGACG
GATTAACTCAGCTGGAAGTTATCGAACTCAGCGAAAACTCGTTCACCGGG
ACACTTGAAGCGTGGTTCTTCCTGTTGCCAGCACTCCAGCAAGTTAACCT
ATCCAATAACACCTTGACACGCGTCGGGATCTCGAAGCCAGTGGATGGCA
GAAGCGACCTGGTGGCGGTTGATCTGGGGTTCAACAAGATCCAAGGGTAC
TTGCCCGTGAATTTCGCTGATTATCCGATGCTGTCGTCTCTGTCGATGCG
TTACAACCGATTACGCGGCGGTATCCCATTGGAGTTCAGTCACAAGAAGT
CTTTGAAGAGGCTGTTTCTGGATGGGAACTTCTTGATTGGGTAAGCACCG
ATAGGATTTTTCAGTGGTGACCTGCCGGTCGCCCGGAGACTGGGGGATAA
TTGTCT
back to top