BQ623352

Overview
NameBQ623352
Unique NameBQ623352
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length692
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig764 contig Csv1_Contig764:731..1424. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623352 vs. ExPASy Swiss-Prot
Match: FAD3E_ARATH (Omega-3 fatty acid desaturase, endoplasmic reticulum OS=Arabidopsis thaliana GN=FAD3 PE=2 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 2.123e-97
Identity = 148/197 (75.13%), Postives = 167/197 (84.77%), Query Frame = 2
Query:    8 LNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPLSEKIYRTLDSATRFLRFKIPFPLLAYPFYLWSRSPGKSGSHFDPNSDLFVPSERKDVITSTVCWTAMAALLVGLSFVMGPMQLLKLYGLPYWIFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGWVNNIHHDIGTHVIHHLF 598
            LNSVVGH+LHS ILVPYHGWRISHRTHHQNHGHVENDESW PL E++Y+ L  +TR LR+ +P P+LAYP YL  RSPGK GSHF+P S LF PSERK + TST CW+ M   L+ LSFV GP+ +LK+YG+PY IFVMWLD VTYLHHHGH++KLPWYRGKEWSYLRGGLTT+DRDYG  NNIHHDIGTHVIHHLF
Sbjct:  114 LNSVVGHILHSFILVPYHGWRISHRTHHQNHGHVENDESWVPLPERVYKKLPHSTRMLRYTVPLPMLAYPLYLCYRSPGKEGSHFNPYSSLFAPSERKLIATSTTCWSIMFVSLIALSFVFGPLAVLKVYGVPYIIFVMWLDAVTYLHHHGHDEKLPWYRGKEWSYLRGGLTTIDRDYGIFNNIHHDIGTHVIHHLF 310          

HSP 2 Score: 39.2762 bits (90), Expect = 2.123e-97
Identity = 16/20 (80.00%), Postives = 19/20 (95.00%), Query Frame = 1
Query:  598 PQIPHYHLIEATEAAKPVLG 657
            PQIPHYHL++AT+AAK VLG
Sbjct:  311 PQIPHYHLVDATKAAKHVLG 330          

HSP 3 Score: 22.7126 bits (47), Expect = 2.123e-97
Identity = 8/10 (80.00%), Postives = 9/10 (90.00%), Query Frame = 3
Query:  657 KYYREPKKSG 686
            +YYREPK SG
Sbjct:  331 RYYREPKTSG 340          
BLAST of BQ623352 vs. ExPASy Swiss-Prot
Match: FAD12_CREAL (Delta(12) fatty acid dehydrogenase OS=Crepis alpina PE=2 SV=2)

HSP 1 Score: 135.191 bits (339), Expect = 5.248e-33
Identity = 78/210 (37.14%), Postives = 119/210 (56.67%), Query Frame = 2
Query:    8 LNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPLSEK----IYRTLDSAT-RFLRFKIPFPLLAYPFYLWSRSPGKS----GSHFDPNSDLFVPSERKDVITSTVCWTAMAALLVGLSFVM---GPMQLLKLYGLPYWIFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGWVNNIHHDI-GTHVIHHLF 598
            ++  VG +LHS ++ PY  W+ SHR HH N   ++NDE + P S+      Y+ L+    R L   I F  L +P YL++   GK      +HFDP S +F   ER  V+ S +    + A+L G+   +   G   +  +YG+P     ++ D++TYLHH      LP Y   EW++LRG L+T+DRD+G++N++ HD+  THV+HHLF
Sbjct:  111 VDDTVGFILHSFLMTPYFSWKYSHRNHHANTNSLDNDEVYIPKSKAKVALYYKVLNHPPGRLLIMFITF-TLGFPLYLFTNISGKKYERFANHFDPMSPIFKERERFQVLLSDL---GLLAVLYGVKLAVAAKGAAWVTCIYGIPVLGVFIFFDIITYLHH--THLSLPHYDSSEWNWLRGALSTIDRDFGFLNSVLHDVTHTHVMHHLF 314          

HSP 2 Score: 26.5646 bits (57), Expect = 5.248e-33
Identity = 11/19 (57.89%), Postives = 13/19 (68.42%), Query Frame = 1
Query:  604 IPHYHLIEATEAAKPVLGN 660
            IPHYH  EA +A   VLG+
Sbjct:  317 IPHYHAKEARDAINTVLGD 335          
BLAST of BQ623352 vs. ExPASy Swiss-Prot
Match: FAD6E_ARATH (Omega-6 fatty acid desaturase, endoplasmic reticulum OS=Arabidopsis thaliana GN=FAD2 PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 6.087e-31
Identity = 74/207 (35.75%), Postives = 104/207 (50.24%), Query Frame = 2
Query:    8 LNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPLSEKIYRTL-----DSATRFLRFKIPFPLLAYPFYLWSRSPGKS----GSHFDPNSDLFVPSERKDVITSTVCWTAMAALLVGLSFVMGPMQLLKLYGLPYWIFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGWVNNIHHDI-GTHVIHHLF 598
            L+  VG + HS +LVPY  W+ SHR HH N G +E DE + P  +   +       +   R +   + F +L +P YL     G+       HF PN+ ++   ER  +  S     A+   L   +   G   ++ LYG+P  I   +L L+TYL H      LP Y   EW +LRG L T+DRDYG +N + H+I  THV HHLF
Sbjct:  118 LDDTVGLIFHSFLLVPYFSWKYSHRRHHSNTGSLERDEVFVPKQKSAIKWYGKYLNNPLGRIMMLTVQF-VLGWPLYLAFNVSGRPYDGFACHFFPNAPIYNDRERLQIYLSDAGILAVCFGLYRYAAAQGMASMICLYGVPLLIVNAFLVLITYLQH--THPSLPHYDSSEWDWLRGALATVDRDYGILNKVFHNITDTHVAHHLF 321          

HSP 2 Score: 30.8018 bits (68), Expect = 6.087e-31
Identity = 11/19 (57.89%), Postives = 17/19 (89.47%), Query Frame = 1
Query:  604 IPHYHLIEATEAAKPVLGN 660
            +PHY+ +EAT+A KP+LG+
Sbjct:  324 MPHYNAMEATKAIKPILGD 342          
BLAST of BQ623352 vs. ExPASy Swiss-Prot
Match: FD6E2_SOYBN (Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 2 OS=Glycine max GN=FAD2-2 PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 1.032e-30
Identity = 72/207 (34.78%), Postives = 105/207 (50.72%), Query Frame = 2
Query:    8 LNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPLSEKIYRTL-----DSATRFLRFKIPFPLLAYPFYLWSRSPGKS----GSHFDPNSDLFVPSERKDVITSTVCWTAMAALLVGLSFVMGPMQLLKLYGLPYWIFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGWVNNIHHDI-GTHVIHHLF 598
            L+ +VG +LHS++LVPY  W+ SHR HH N G +E DE + P  +   +       +   R L   +    L +P YL     G+       H+DP   ++   ER  +  S     A+   L  L+   G   ++ +YG+P  +   +L L+T+L H      LP Y   EW +LRG L T+DRDYG +N + H+I  THV HHLF
Sbjct:  118 LDDIVGLILHSALLVPYFSWKYSHRRHHSNTGSLERDEVFVPKQKSCIKWYSKYLNNPPGRVLTLAVTL-TLGWPLYLALNVSGRPYDRFACHYDPYGPIYSDRERLQIYISDAGVLAVVYGLFRLAMAKGLAWVVCVYGVPLLVVNGFLVLITFLQH--THPALPHYTSSEWDWLRGALATVDRDYGILNKVFHNITDTHVAHHLF 321          

HSP 2 Score: 33.113 bits (74), Expect = 1.032e-30
Identity = 12/18 (66.67%), Postives = 16/18 (88.89%), Query Frame = 1
Query:  604 IPHYHLIEATEAAKPVLG 657
            +PHYH +EAT+A KP+LG
Sbjct:  324 MPHYHAMEATKAIKPILG 341          
BLAST of BQ623352 vs. ExPASy Swiss-Prot
Match: FAD6E_BRAJU (Omega-6 fatty acid desaturase, endoplasmic reticulum OS=Brassica juncea PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 3.864e-30
Identity = 76/216 (35.19%), Postives = 105/216 (48.61%), Query Frame = 2
Query:    8 LNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHP------------LSEKIYRTLDSATRFLRFKIPFPLLAYPFYLWSRS------PGKSGSHFDPNSDLFVPSERKDVITSTVCWTAMAALLVGLSFVMGPMQLLKLYGLPYWIFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGWVNNIHHDI-GTHVIHHLF 598
            L+  VG + HS +LVPY  W+ SHR HH N G +E DE + P            L+  + RT+    +F         L +P Y W+ +      P     HF PN+ ++   ER  +  S     A+   L   +   G   ++ LYG+P  I   +L L+TYL H      LP Y   EW +LRG L T+DRDYG +N + H+I  THV HHLF
Sbjct:  118 LDDTVGLIFHSFLLVPYFSWKYSHRRHHSNTGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQF--------TLGWPLY-WAFNVSGRPYPEGFACHFHPNAPIYNDRERLQIYVSDAGILAVCYGLYRYAAAQGVASMVCLYGVPLLIVNAFLVLITYLQH--THPSLPHYDSSEWDWLRGALATVDRDYGILNKVFHNITDTHVAHHLF 322          

HSP 2 Score: 31.9574 bits (71), Expect = 3.864e-30
Identity = 11/19 (57.89%), Postives = 16/19 (84.21%), Query Frame = 1
Query:  604 IPHYHLIEATEAAKPVLGN 660
            +PHYH +E T+A KP+LG+
Sbjct:  325 MPHYHAMEVTKAIKPILGD 343          
BLAST of BQ623352 vs. ExPASy Swiss-Prot
Match: FD6E1_SOYBN (Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 1 OS=Glycine max GN=FAD2-1 PE=2 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 1.110e-29
Identity = 74/207 (35.75%), Postives = 107/207 (51.69%), Query Frame = 2
Query:    8 LNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHP--------LSEKIYRTLDSATRFL-RFKIPFPLLAYPFYLWSRSPGKSGSHFDPNSDLFVPSERKDVITSTVCWTAMAALLVGLSFVMGPMQLLKLYGLPYWIFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGWVNNI-HHDIGTHVIHHLF 598
            ++ VVG  LHS++LVPY  W+ISHR HH N G ++ DE + P         S+ +   L  A   L    I +P+    F +  R      SH+ P + ++   ER  +  S V   ++   L  ++ + G + LL +YG+P  I   +L  +TYL H      LP Y   EW +L+G L T+DRDYG +N + HH   THV HHLF
Sbjct:  122 VDDVVGLTLHSTLLVPYFSWKISHRRHHSNTGSLDRDEVFVPKPKSKVAWFSKYLNNPLGRAVSLLVTLTIGWPMY-LAFNVSGRPYDSFASHYHPYAPIYSNRERLLIYVSDVALFSVTYSLYRVATLKGLVWLLCVYGVPLLIVNGFLVTITYLQH--THFALPHYDSSEWDWLKGALATMDRDYGILNKVFHHITDTHVAHHLF 325          

HSP 2 Score: 32.7278 bits (73), Expect = 1.110e-29
Identity = 12/18 (66.67%), Postives = 15/18 (83.33%), Query Frame = 1
Query:  604 IPHYHLIEATEAAKPVLG 657
            +PHYH +EAT A KP+LG
Sbjct:  328 MPHYHAMEATNAIKPILG 345          
BLAST of BQ623352 vs. ExPASy Swiss-Prot
Match: FAD12_MORIS (Delta(12) fatty acid desaturase OS=Mortierella isabellina PE=2 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 6.690e-26
Identity = 73/223 (32.74%), Postives = 110/223 (49.33%), Query Frame = 2
Query:    8 LNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPLSEK--------------------IYRTLDSATRFLRFKIPFPLLAYPFYLWSRSPGKS----GSHFDPNSDLFVPSERKDVITSTVCWTAMAALLVGLSFVMGPMQLLKLYGLPYWIFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYG-WVNNIHHDI-GTHVIHHLF 598
            LN+ VG +LHS +LVPYH WRISH  HH+  GH+  D+ + P +                      ++   ++    L + +   L  +P YL   + G+      SHF   S +F P    D+I S +   A    L+  S  +  + + K Y +PY     WL L+T+L H   + KLP YR   W++ RG L T+DR +G +++++ H I  THV HHLF
Sbjct:  125 LNNTVGWILHSMLLVPYHSWRISHSKHHKATGHMTKDQVFVPKTRSQVGLPPKESAAAAVQEEDMSVHLDEEAPIVTLFWMVIQFLFGWPAYLIMNASGQDYGRWTSHFHTYSPIFEPRNFFDIIISDLGVLAALGALIYASMQLSLLTVTKYYIIPYLFVNFWLVLITFLQH--TDPKLPHYREGAWNFQRGALCTVDRSFGKFLDHMFHGIVHTHVAHHLF 345          

HSP 2 Score: 23.0978 bits (48), Expect = 6.690e-26
Identity = 11/23 (47.83%), Postives = 13/23 (56.52%), Query Frame = 1
Query:  601 QIPHYHLIEATEAAKPVLGNITV 669
            Q+P YH  EAT   K +LG   V
Sbjct:  347 QMPFYHAEEATYHLKKLLGEYYV 369          
BLAST of BQ623352 vs. ExPASy Swiss-Prot
Match: FAD12_MORAP (Delta(12) fatty acid desaturase OS=Mortierella alpina PE=2 SV=2)

HSP 1 Score: 114.39 bits (285), Expect = 8.707e-26
Identity = 73/223 (32.74%), Postives = 110/223 (49.33%), Query Frame = 2
Query:    8 LNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPLSEK--------------------IYRTLDSATRFLRFKIPFPLLAYPFYLWSRSPGKS----GSHFDPNSDLFVPSERKDVITSTVCWTAMAALLVGLSFVMGPMQLLKLYGLPYWIFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYG-WVNNIHHDI-GTHVIHHLF 598
            LN+ VG +LHS +LVPYH WRISH  HH+  GH+  D+ + P +                      ++   ++    L + +   L  +P YL   + G+      SHF   S +F P    D+I S +   A    L+  S  +  + + K Y +PY     WL L+T+L H   + KLP YR   W++ RG L T+DR +G +++++ H I  THV HHLF
Sbjct:  125 LNNTVGWILHSMLLVPYHSWRISHSKHHKATGHMTKDQVFVPKTRSQVGLPPKENAAAAVQEEDMSVHLDEEAPIVTLFWMVIQFLFGWPAYLIMNASGQDYGRWTSHFHTYSPIFEPRNFFDIIISDLGVLAALGALIYASMQLSLLTVTKYYIVPYLFVNFWLVLITFLQH--TDPKLPHYREGAWNFQRGALCTVDRSFGKFLDHMFHGIVHTHVAHHLF 345          

HSP 2 Score: 23.0978 bits (48), Expect = 8.707e-26
Identity = 11/23 (47.83%), Postives = 13/23 (56.52%), Query Frame = 1
Query:  601 QIPHYHLIEATEAAKPVLGNITV 669
            Q+P YH  EAT   K +LG   V
Sbjct:  347 QMPFYHAEEATYHLKKLLGEYYV 369          
BLAST of BQ623352 vs. ExPASy Swiss-Prot
Match: DESA_SYNY3 (Fatty acid desaturase OS=Synechocystis sp. (strain PCC 6803) GN=desA PE=3 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.039e-13
Identity = 51/199 (25.63%), Postives = 89/199 (44.72%), Query Frame = 2
Query:    8 LNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPLSEKIYRTLDSATRFLRFKIPFPLLAYPFYLWSRSPGKSGSHFDPNSDLFVPSERKDV-ITSTVCWTAMAALLVGLSFVMGPMQLLKLYGLPYWIFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLT-TLDRDY-GWVNNIHHDIGTHVIHHL 595
            +N +VGH+  + ++ P+H WR+ H  HH +   +E D +W P S + ++   +  R       +  +  PF+        S  HF  ++  F   +R  V ++  V +   A     L    G    +K + +P+ ++  W+   T +HH   E  + +    +WS     L  T+  DY  WV  + HDI  H+ HHL
Sbjct:  103 VNDLVGHIAFAPLIYPFHSWRLLHDHHHLHTNKIEVDNAWDPWSVEAFQASPAIVRLF-----YRAIRGPFWWTGSIFHWSLMHFKLSN--FAQRDRNKVKLSIAVVFLFAAIAFPALIITTGVWGFVKFWLMPWLVYHFWMSTFTIVHHTIPE--IRFRPAADWSAAEAQLNGTVHCDYPRWVEVLCHDINVHIPHHL 292          
BLAST of BQ623352 vs. ExPASy Swiss-Prot
Match: DESA_SPIPL (Fatty acid desaturase OS=Spirulina platensis GN=desA PE=3 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.357e-13
Identity = 52/199 (26.13%), Postives = 94/199 (47.24%), Query Frame = 2
Query:    8 LNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPLSEKIYRTLDSATRFLRFKIPFPLLAYPFYLWSRSPGKSGSHFDPNSDLFVPSERKDVITSTVCWTAMAAL-LVGLSFVMGPMQLLKLYGLPYWIFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLT-TLDRDYG-WVNNIHHDIGTHVIHHL 595
            +N  VGH+L   I+ P+H WRI H  HH+    +E D +W P  ++ Y+   +A +F+  ++ + L     +        +  HFD     F   +R+ V  S++     AA+    +   +G    +K + +P+ +F  W+   T LHH   +  +P+   ++W      L+ T+  +Y  W   + HDI  H+ HH+
Sbjct:  102 VNDWVGHILFLPIIYPFHSWRIGHNQHHKYTNRMELDNAWQPWRKEEYQ---NAGKFM--QVTYDLFRGRAWWIGSILHWASIHFDWTK--FEGKQRQQVKFSSLLVIGAAAIAFPTMILTIGVWGFVKFWVIPWLVFHFWMSTFTLLHHTIAD--IPFREPEQWHEAESQLSGTVHCNYSRWGEFLCHDINVHIPHHV 291          
The following BLAST results are available for this feature:
BLAST of BQ623352 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 22
Match NameE-valueIdentityDescription
FAD3E_ARATH2.123e-9775.13Omega-3 fatty acid desaturase, endoplasmic reticul... [more]
FAD12_CREAL5.248e-3337.14Delta(12) fatty acid dehydrogenase OS=Crepis alpin... [more]
FAD6E_ARATH6.087e-3135.75Omega-6 fatty acid desaturase, endoplasmic reticul... [more]
FD6E2_SOYBN1.032e-3034.78Omega-6 fatty acid desaturase, endoplasmic reticul... [more]
FAD6E_BRAJU3.864e-3035.19Omega-6 fatty acid desaturase, endoplasmic reticul... [more]
FD6E1_SOYBN1.110e-2935.75Omega-6 fatty acid desaturase, endoplasmic reticul... [more]
FAD12_MORIS6.690e-2632.74Delta(12) fatty acid desaturase OS=Mortierella isa... [more]
FAD12_MORAP8.707e-2632.74Delta(12) fatty acid desaturase OS=Mortierella alp... [more]
DESA_SYNY31.039e-1325.63Fatty acid desaturase OS=Synechocystis sp. (strain... [more]
DESA_SPIPL1.357e-1326.13Fatty acid desaturase OS=Spirulina platensis GN=de... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00443 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00443 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623352 ID=BQ623352|Name=BQ623352|organism=Citrus sinensis|type=EST|length=692bp
TCACAAGTTGAATAGTGTGGTGGGGCATCTGCTGCATTCTTCAATTCTGG
TTCCTTATCATGGATGGAGAATTAGCCACAGGACTCATCATCAAAACCAT
GGGCATGTTGAGAATGATGAATCCTGGCACCCGTTGTCTGAGAAAATTTA
CAGGACTTTGGATAGTGCAACAAGATTTTTGAGATTCAAAATTCCTTTTC
CCTTGCTTGCATATCCCTTTTATCTTTGGAGTAGGAGTCCGGGGAAGTCT
GGTTCTCACTTTGACCCTAACAGTGACCTGTTTGTCCCAAGTGAGAGGAA
GGATGTGATCACTTCAACAGTATGCTGGACGGCCATGGCTGCTTTGCTAG
TGGGTTTATCATTTGTAATGGGTCCTATGCAGTTGCTTAAACTCTATGGC
CTTCCATATTGGATTTTTGTCATGTGGCTGGACCTTGTGACTTACTTGCA
TCACCATGGGCATGAAGACAAACTTCCGTGGTATCGTGGAAAGGAATGGA
GTTACTTAAGGGGAGGGCTCACAACACTTGATCGTGACTATGGATGGGTC
AATAACATCCACCACGATATTGGAACCCACGTCATACATCACCTCTTCCT
CAGATCCCGCATTACCACTTAATAGAAGCAACTGAGGCTGCTAAACCAGT
TCTTGGAAATATTACCGTGAGCCAAAGAAATCGGGGACCGAT
back to top