BQ623353

Overview
NameBQ623353
Unique NameBQ623353
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length562
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9230 contig Csv1_Contig9230:445..1005. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB2G_SOLLC (Chlorophyll a-b binding protein 3C, chloroplastic OS=Solanum lycopersicum GN=CAB3C PE=3 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 7.400e-16
Identity = 58/162 (35.80%), Postives = 81/162 (50.00%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G    +    Y GGS DP               D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  113 GCVFPELLARNGVKFGEAV--WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAG----GPLGE---VVDPLYPGGSFDPL----------GLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 255          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB26_ARATH (Chlorophyll a-b binding protein CP26, chloroplastic OS=Arabidopsis thaliana GN=LHCB5 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 7.400e-16
Identity = 65/164 (39.63%), Postives = 82/164 (50.00%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGVIPPAG-TYNYWAD--PYTLF---VLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYL--GGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNNVLT 469
            G I PE L K G      A+ WF+TG +   G T NY+    P  L    V E+ L+G AE+ R  +            L FE  L  GG  DP              KD +     K+KE+KNGRLAM A+LG+F+Q  VTG GP +NL  HL+DP  NN+LT
Sbjct:  127 GFIIPEALNKYGANCGPEAV-WFKTGALLLDGNTLNYFGKNIPINLVLAVVAEVVLLGGAEYYRITNG-----------LDFEDKLHPGGPFDPL----------GLAKDPEQGALLKVKEIKNGRLAMFAMLGFFIQAYVTGEGPVENLAKHLSDPFGNNLLT 268          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB22_TOBAC (Chlorophyll a-b binding protein 21, chloroplastic OS=Nicotiana tabacum GN=CAB21 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 7.400e-16
Identity = 58/162 (35.80%), Postives = 82/162 (50.62%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G    +    Y GGS DP              +D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  111 GCVFPELLARNGVKFGEAV--WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAG----GPLGE---VVDPLYPGGSFDPL----------GLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 253          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB2A_SPIOL (Chlorophyll a-b binding protein, chloroplastic OS=Spinacia oleracea PE=1 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 9.664e-16
Identity = 58/162 (35.80%), Postives = 81/162 (50.00%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G    +    Y GGS DP               D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  113 GCVFPELLARNGVKFGEAV--WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAG----GPLGE---VVDPLYPGGSFDPL----------GLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 255          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB27_TOBAC (Chlorophyll a-b binding protein 7, chloroplastic OS=Nicotiana tabacum GN=CAB7 PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 9.664e-16
Identity = 58/162 (35.80%), Postives = 81/162 (50.00%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G    +    Y GGS DP               D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP  NL+DHLADPVNNN
Sbjct:  113 GCVFPELLARNGVKFGEAV--WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAIEGYRVAG----GPLGE---VTDPLYPGGSFDPL----------GLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLDNLVDHLADPVNNN 255          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB25_PETSP (Chlorophyll a-b binding protein 91R, chloroplastic OS=Petunia sp. GN=CAB91R PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 9.664e-16
Identity = 58/162 (35.80%), Postives = 81/162 (50.00%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G    +    Y GGS DP               D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  113 GCVFPELLARNGVKFGEAV--WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAG----GPLGE---VVDPLYPGGSFDPL----------GLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 255          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB23_TOBAC (Chlorophyll a-b binding protein 36, chloroplastic OS=Nicotiana tabacum GN=CAB36 PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 9.664e-16
Identity = 59/163 (36.20%), Postives = 82/163 (50.31%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEK-YLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PEIL K G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G     G +K Y GG+ DP               D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DH+ADPV NN
Sbjct:  111 GCVFPEILSKNGVKFGEAV--WFKAGSQIFSEGGLDYLGNPNLIHAQSILAVWASQVVLMGLIEGYR----VGGGPLGE----GLDKIYPGGAFDPL----------GLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANN 253          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB23_PETSP (Chlorophyll a-b binding protein 22R, chloroplastic OS=Petunia sp. GN=CAB22R PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 9.664e-16
Identity = 57/162 (35.19%), Postives = 80/162 (49.38%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+  + G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G         Y GGS DP              +D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  113 GCVFPELFARNGIKFGEAV--WFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAG----GPLGEVID---PLYPGGSFDPL----------GLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 255          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB22_SOYBN (Chlorophyll a-b binding protein 2, chloroplastic OS=Glycine max GN=CAB2 PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 9.664e-16
Identity = 58/162 (35.80%), Postives = 82/162 (50.62%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G    +    Y GGS DP               D +++ + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  102 GCVFPELLARNGVKFGEAV--WFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAG----GPLGE---VTDPIYPGGSFDPL----------GLADDPEALAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 244          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB21_PINTH (Chlorophyll a-b binding protein type I, chloroplastic OS=Pinus thunbergii PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 9.664e-16
Identity = 59/163 (36.20%), Postives = 82/163 (50.31%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYL-GGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L K GL   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G++G     G +  L GG+ DP               D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPV NN
Sbjct:  112 GCVFPELLAKNGLKFGEAV--WFKAGAQIFSEGGLDYAGNPNLIHAQSILAIWACQVVLMGLIEGYR----VGGGTLGE----GLDPLLPGGAFDPL----------GLADDPEACAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHLADPVANN 254          
The following BLAST results are available for this feature:
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
CB2G_SOLLC7.400e-1635.80Chlorophyll a-b binding protein 3C, chloroplastic ... [more]
CB26_ARATH7.400e-1639.63Chlorophyll a-b binding protein CP26, chloroplasti... [more]
CB22_TOBAC7.400e-1635.80Chlorophyll a-b binding protein 21, chloroplastic ... [more]
CB2A_SPIOL9.664e-1635.80Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB27_TOBAC9.664e-1635.80Chlorophyll a-b binding protein 7, chloroplastic O... [more]
CB25_PETSP9.664e-1635.80Chlorophyll a-b binding protein 91R, chloroplastic... [more]
CB23_TOBAC9.664e-1636.20Chlorophyll a-b binding protein 36, chloroplastic ... [more]
CB23_PETSP9.664e-1635.19Chlorophyll a-b binding protein 22R, chloroplastic... [more]
CB22_SOYBN9.664e-1635.80Chlorophyll a-b binding protein 2, chloroplastic O... [more]
CB21_PINTH9.664e-1636.20Chlorophyll a-b binding protein type I, chloroplas... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00444 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00444 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623353 ID=BQ623353|Name=BQ623353|organism=Citrus sinensis|type=EST|length=562bp
GGGAGCCATTGCACCGGAGATTCTTGGCAAGGCAGGCCTCATTCCGCAAG
AAACTGCCCTGGCCTGGTTCCAAACCGGTGTGATCCCCCCAGCGGGAACA
TACAACTACTGGGCAGACCCTTACACACTTTTCGTCCTGGAAATGGCACT
CATGGGATTTGCCGAGCACCGGAGATTCCAAGACTGGGCAAATCCAGGAT
CAATGGGCAGGCAATACTTCCTCGGATTCGAGAAATACTTGGGAGGATCC
GGCGATCCGGCTTACCCTGGAGGACCTCTATTCAACCCTCTGGGTCTTGG
GAAAGATGAGAAGTCAATGAAGGATTTCAAGCTCAAGGAAGTGAAGAATG
GAAGATTGGCAATGTTGGCAATCTTGGGTTACTTTGTTCAAGGTCTTGTT
ACAGGAGTTGGGCCTTACCAGAACCTATTGGATCACTTGGCTGATCCTGT
AAACAACAATGTTTTGACTAGCCTATAGTTTCACTGAGAGAGAAATTTCT
TGTTCATTGCTTTGGAATTATATATTCCAAGCCTTGTCATCCCCCACTCT
GTTCTATTCTAC
back to top