BQ623353

Overview
NameBQ623353
Unique NameBQ623353
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length562
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9230 contig Csv1_Contig9230:445..1005. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB25_TOBAC (Chlorophyll a-b binding protein 50, chloroplastic OS=Nicotiana tabacum GN=CAB50 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 2.153e-15
Identity = 57/162 (35.19%), Postives = 81/162 (50.00%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G    +    Y GGS DP              +D ++  + K+K +KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  113 GCVFPELLARNGVKFGEAV--WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAG----GPLGE---VVDPLYPGGSFDPL----------GLAEDPEAFAELKVKHIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 255          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB21_MAIZE (Chlorophyll a-b binding protein 1, chloroplastic OS=Zea mays GN=CAB1 PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 2.153e-15
Identity = 57/162 (35.19%), Postives = 81/162 (50.00%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G    +    Y GGS DP               D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DH+ADPVNNN
Sbjct:  108 GCVFPELLSRNGVKFGEAV--WFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG----GPLGE---VVDPLYPGGSFDPL----------GLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNN 250          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB25_NICPL (Chlorophyll a-b binding protein E, chloroplastic OS=Nicotiana plumbaginifolia GN=CABE PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 2.812e-15
Identity = 58/162 (35.80%), Postives = 81/162 (50.00%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R         +G    +    Y GGS DP              +D ++  + K+KE+KNGRLAM ++ G+FVQ LVTG GP +NL DHLADPVNNN
Sbjct:  112 GCVFPELLARNGVKFGEAV--WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAG----EPLGE---VVDPLYPGGSFDPL----------GLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQALVTGKGPLENLADHLADPVNNN 254          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB215_PEA (Chlorophyll a-b binding protein 215, chloroplastic OS=Pisum sativum GN=CAB215 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 2.812e-15
Identity = 60/163 (36.81%), Postives = 80/163 (49.08%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEK-YLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G   PE+L K G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMGF E  R       G +G     G +  Y GG+ DP               D  S  + K+KE+KNGRLAM ++ G+FVQ +VTG GP QNL DH+ADPV NN
Sbjct:  111 GCTFPELLEKNGVKFGEAV--WFKAGSQIFAEGGLDYLGNPNLIHAQSILAIWATQVVLMGFVEGYR----VGGGPLGE----GLDPLYPGGAFDPL----------GLADDPDSFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIQNLYDHVADPVANN 253          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB28_PEA (Chlorophyll a-b binding protein 8, chloroplastic OS=Pisum sativum GN=CAB8 PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 3.672e-15
Identity = 57/162 (35.19%), Postives = 81/162 (50.00%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G    +    Y GGS DP               D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHL+DPVNNN
Sbjct:  114 GCVFPELLSRNGVKFGEAV--WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAG----GPLGE---VVDPLYPGGSFDPL----------GLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPVNNN 256          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB24_PETSP (Chlorophyll a-b binding protein 25, chloroplastic OS=Petunia sp. GN=CAB25 PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 3.672e-15
Identity = 57/162 (35.19%), Postives = 79/162 (48.77%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+  + G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G         Y GGS DP               D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  112 GCVFPELFARNGVKFGEAV--WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAG----GPLGEVID---PLYPGGSFDPL----------GLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 254          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB2A_PINSY (Chlorophyll a-b binding protein type 2 member 1A, chloroplastic OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 4.796e-15
Identity = 57/162 (35.19%), Postives = 79/162 (48.77%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADPY--------TLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y   P          ++  ++ LMG  E  R       G +G    +    Y GG+ DP               D  +  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  124 GCVFPELLARNGVKFGEAV--WFKAGAQIFSEGGLDYLGSPQLIHAQSILAIWACQVILMGAIEGYRVAG----GPLGE---VTDPIYPGGNFDPL----------GLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNN 266          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB22_MAIZE (Chlorophyll a-b binding protein, chloroplastic OS=Zea mays PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 4.796e-15
Identity = 57/162 (35.19%), Postives = 81/162 (50.00%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G    +    Y GGS DP               D ++  + K+KE+K GRLAML++ G+FVQ +VTG GP +NL DH+ADPVNNN
Sbjct:  111 GCVFPELLARNGVKFGEAV--WFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG----GPLGE---VVDPLYPGGSFDPL----------GLADDPEAFGELKVKELKKGRLAMLSMFGFFVQAIVTGKGPLENLADHIADPVNNN 253          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB2_DUNSA (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Dunaliella salina PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 6.264e-15
Identity = 58/163 (35.58%), Postives = 76/163 (46.63%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADPYTL--------FVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEK-YLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L     I    A  WF+ G  I   G  NY  +P  +          +++ LMG  E  R     N G  G     G +  Y G + DP               D  +  + K+KE+KNGRLAM A LG+FVQ +VTG GP +NL DHLA+P  NN
Sbjct:  118 GMVTPELLADEDGIKFGDAAIWFKAGAAIFQDGGLNYLGNPSLIHAQNIVATLAVQVVLMGLVEGYR----VNGGPAGE----GLDPLYPGEAFDPL----------GLADDPDTFAELKVKEIKNGRLAMFACLGFFVQAIVTGKGPIENLTDHLANPAENN 262          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB23_NICPL (Chlorophyll a-b binding protein C, chloroplastic OS=Nicotiana plumbaginifolia GN=CABC PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 8.181e-15
Identity = 57/162 (35.19%), Postives = 81/162 (50.00%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R         +G    +    Y GGS DP              +D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  113 GCVFPELLARNGVKFGEAV--WFKGGSQIFSQGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAG----EPLGE---VVDPLYPGGSFDPL----------GLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 255          
The following BLAST results are available for this feature:
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
CB25_TOBAC2.153e-1535.19Chlorophyll a-b binding protein 50, chloroplastic ... [more]
CB21_MAIZE2.153e-1535.19Chlorophyll a-b binding protein 1, chloroplastic O... [more]
CB25_NICPL2.812e-1535.80Chlorophyll a-b binding protein E, chloroplastic O... [more]
CB215_PEA2.812e-1536.81Chlorophyll a-b binding protein 215, chloroplastic... [more]
CB28_PEA3.672e-1535.19Chlorophyll a-b binding protein 8, chloroplastic O... [more]
CB24_PETSP3.672e-1535.19Chlorophyll a-b binding protein 25, chloroplastic ... [more]
CB2A_PINSY4.796e-1535.19Chlorophyll a-b binding protein type 2 member 1A, ... [more]
CB22_MAIZE4.796e-1535.19Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB2_DUNSA6.264e-1535.58Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB23_NICPL8.181e-1535.19Chlorophyll a-b binding protein C, chloroplastic O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00444 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00444 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623353 ID=BQ623353|Name=BQ623353|organism=Citrus sinensis|type=EST|length=562bp
GGGAGCCATTGCACCGGAGATTCTTGGCAAGGCAGGCCTCATTCCGCAAG
AAACTGCCCTGGCCTGGTTCCAAACCGGTGTGATCCCCCCAGCGGGAACA
TACAACTACTGGGCAGACCCTTACACACTTTTCGTCCTGGAAATGGCACT
CATGGGATTTGCCGAGCACCGGAGATTCCAAGACTGGGCAAATCCAGGAT
CAATGGGCAGGCAATACTTCCTCGGATTCGAGAAATACTTGGGAGGATCC
GGCGATCCGGCTTACCCTGGAGGACCTCTATTCAACCCTCTGGGTCTTGG
GAAAGATGAGAAGTCAATGAAGGATTTCAAGCTCAAGGAAGTGAAGAATG
GAAGATTGGCAATGTTGGCAATCTTGGGTTACTTTGTTCAAGGTCTTGTT
ACAGGAGTTGGGCCTTACCAGAACCTATTGGATCACTTGGCTGATCCTGT
AAACAACAATGTTTTGACTAGCCTATAGTTTCACTGAGAGAGAAATTTCT
TGTTCATTGCTTTGGAATTATATATTCCAAGCCTTGTCATCCCCCACTCT
GTTCTATTCTAC
back to top