BQ623355

Overview
NameBQ623355
Unique NameBQ623355
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length619
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4610 contig Csv1_Contig4610:525..1143. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: TIP31_ARATH (Aquaporin TIP3-1 OS=Arabidopsis thaliana GN=TIP3-1 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 5.252e-16
Identity = 48/111 (43.24%), Postives = 67/111 (60.36%), Query Frame = 2
Query:   83 LADGYSTGTGLGAEIIGTFVLVYTVFSAT-DPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL 412
            LA G     GL  EII TF LVY V+S   DPKR +    + ++APL IG  V    L   P +G  +NPAR+ G A++  +   W D WI+WVGPFIG+A+AA  +++++
Sbjct:  143 LASGVGAVNGLVLEIILTFGLVYVVYSTLIDPKRGS----LGIIAPLAIGLIVGANILVGGPFSGASMNPARAFGPALVGWR---WHDHWIYWVGPFIGSALAALIYEYMV 246          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: TIP12_ORYSJ (Probable aquaporin TIP1-2 OS=Oryza sativa subsp. japonica GN=TIP1-2 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.170e-15
Identity = 56/143 (39.16%), Postives = 76/143 (53.15%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGA------EIIGTFVLVYTVFS-ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFI 409
            LG++  C L+K          GG A      +S   G+GA      EI+ TF LVYTV++ A DPK+      + V+AP+ IGF V    LA     G  +NPA S G AV+      WD+ W++W+GPF+GAAIAA  +  I
Sbjct:  112 LGSVVACLLLKIAT-------GGAA---VGAFSLSAGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKG----DLGVIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPAVVTG---VWDNHWVYWLGPFVGAAIAALIYDII 237          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP5_PIG (Aquaporin-5 OS=Sus scrofa GN=AQP5 PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.996e-15
Identity = 51/138 (36.96%), Postives = 75/138 (54.35%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAP-LPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL 412
            +GAI G G++         R     N L +  + G  +  E+I TF L   +FS+TD +R +     PV +P L IG +V + HL  I  TG  +NPARS G AV+ ++       W+FWVGP +GAA+AA  + ++L
Sbjct:   96 VGAIAGAGILYGLAPGN-ARGNLAVNSLNNNTTPGQAVVVEMILTFQLALCIFSSTDSRRTS-----PVGSPALSIGLSVTLGHLVGIYFTGCSMNPARSFGPAVVMNRFSP--SHWVFWVGPIVGAAVAAILYFYLL 225          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP2_SHEEP (Aquaporin-2 OS=Ovis aries GN=AQP2 PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.996e-15
Identity = 47/137 (34.31%), Postives = 71/137 (51.82%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL 412
            LGA+ G  L+         R     N L +  + G  +  E+  T  LV  +F +TD +R  +  H      L IGF+V + HL  I  TG  +NPARSL  A++  K   +DD W+FW+GP +GA +A+  + ++L
Sbjct:   95 LGAVAGAALLHEITPPAI-RGDLAVNALNNNSTAGQAVTVELFLTLQLVLCIFPSTDKRRGKQLGH----PALSIGFSVALGHLLGIHYTGCSMNPARSLAPAIVTGK---FDDHWVFWIGPLVGAIVASLLYNYVL 223          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP2_HUMAN (Aquaporin-2 OS=Homo sapiens GN=AQP2 PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.996e-15
Identity = 47/137 (34.31%), Postives = 72/137 (52.55%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL 412
            LGA+ G  L+     +   R     N L++  + G  +  E+  T  LV  +F++TD +R       P    L IGF+V + HL  I  TG  +NPARSL  AV+  K   +DD W+FW+GP +GA + +  + ++L
Sbjct:   95 LGAVAGAALLHEITPADI-RGDLAVNALSNSTTAGQAVTVELFLTLQLVLCIFASTDERRGEN----PGTPALSIGFSVALGHLLGIHYTGCSMNPARSLAPAVVTGK---FDDHWVFWIGPLVGAILGSLLYNYVL 223          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: MIP_CHICK (Lens fiber major intrinsic protein OS=Gallus gallus GN=MIP PE=1 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 4.446e-15
Identity = 48/137 (35.04%), Postives = 73/137 (53.28%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL 412
            LGA+ G G++     +   R   G + L      G G   E++ T   +  VF++ D + + R    P  A LP+GF++ + HL  IP TG G+NPARS   AVI    + + + W+FW GP +GAA+AA  ++  L
Sbjct:   95 LGALAGAGVLYGVTPAA-VRGTLGLSALHPSVGPGQGTVVELLLTAQFILCVFASFDDRHDGR----PGSAALPVGFSLALGHLFGIPFTGAGMNPARSFAPAVI---TRNFTNHWVFWAGPLLGAALAALLYELAL 223          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQPZ_PSEPK (Aquaporin Z OS=Pseudomonas putida (strain KT2440) GN=aqpZ PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 5.807e-15
Identity = 48/135 (35.56%), Postives = 70/135 (51.85%), Query Frame = 2
Query:    2 LGAICGCGLV-------KAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAI 385
            +GAI   G++         F+ S      G A+    GY+ G G  +E++ T + +  +  ATD +  A        AP+ IG A+ ++HL +IPVT T +NPARS G A ++    A    W+FWV P IGAAI
Sbjct:   91 IGAILAAGVIYLIASGKAGFELSAGLASNGYADHSPGGYTLGAGFVSEVVMTAMFLVVIMGATDARAPAG------FAPIAIGLALTLIHLISIPVTNTSVNPARSTGPA-LFVGGWALQQLWLFWVAPLIGAAI 218          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP5_MOUSE (Aquaporin-5 OS=Mus musculus GN=Aqp5 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 5.807e-15
Identity = 51/142 (35.92%), Postives = 77/142 (54.23%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAP-LPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASA 424
            +GAI G G++         R     N L++  + G  +  E+I TF L   +FS+TD +R +     PV +P L IG +V + HL  I  TG  +NPARS G AV+ ++       W+FWVGP +GA +AA  + ++L  S+
Sbjct:   96 VGAIAGAGILYWLAPGN-ARGNLAVNALSNNTTPGKAVVVELILTFQLALCIFSSTDSRRTS-----PVGSPALSIGLSVTLGHLVGIYFTGCSMNPARSFGPAVVMNRFS--PSHWVFWVGPIVGAVLAAILYFYLLFPSS 229          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP5_RAT (Aquaporin-5 OS=Rattus norvegicus GN=Aqp5 PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 9.905e-15
Identity = 51/142 (35.92%), Postives = 77/142 (54.23%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAP-LPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASA 424
            +GAI G G++  +      R     N L +  + G  +  E+I TF L   +FS+TD +R +     PV +P L IG +V + HL  I  TG  +NPARS G AV+ ++       W+FWVGP +GA +AA  + ++L  S+
Sbjct:   96 VGAIAGAGILY-WLAPLNARGNLAVNALNNNTTPGKAMVVELILTFQLALCIFSSTDSRRTS-----PVGSPALSIGLSVTLGHLVGIYFTGCSMNPARSFGPAVVMNRFS--PSHWVFWVGPIVGAMLAAILYFYLLFPSS 229          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP2_BOVIN (Aquaporin-2 OS=Bos taurus GN=AQP2 PE=2 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 1.294e-14
Identity = 47/137 (34.31%), Postives = 72/137 (52.55%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL 412
            LGA+ G  L+         R     N L +  + G  +  E+  T  LV  +F++TD +R       P L+   IGF+V + HL  I  TG  +NPARSL  A++  K   +DD W+FW+GP +GA +A+  + ++L
Sbjct:   95 LGAVAGAALLHEITPPAI-RGDLAVNALNNNSTAGQAVTVELFLTLQLVLCIFASTDERRGDNVG-TPALS---IGFSVALGHLLGIHYTGCSMNPARSLAPAIVTGK---FDDHWVFWIGPLVGAIVASLLYNYVL 223          
The following BLAST results are available for this feature:
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 134
Match NameE-valueIdentityDescription
TIP31_ARATH5.252e-1643.24Aquaporin TIP3-1 OS=Arabidopsis thaliana GN=TIP3-1... [more]
TIP12_ORYSJ1.170e-1539.16Probable aquaporin TIP1-2 OS=Oryza sativa subsp. j... [more]
AQP5_PIG1.996e-1536.96Aquaporin-5 OS=Sus scrofa GN=AQP5 PE=2 SV=1[more]
AQP2_SHEEP1.996e-1534.31Aquaporin-2 OS=Ovis aries GN=AQP2 PE=2 SV=1[more]
AQP2_HUMAN1.996e-1534.31Aquaporin-2 OS=Homo sapiens GN=AQP2 PE=1 SV=1[more]
MIP_CHICK4.446e-1535.04Lens fiber major intrinsic protein OS=Gallus gallu... [more]
AQPZ_PSEPK5.807e-1535.56Aquaporin Z OS=Pseudomonas putida (strain KT2440) ... [more]
AQP5_MOUSE5.807e-1535.92Aquaporin-5 OS=Mus musculus GN=Aqp5 PE=2 SV=1[more]
AQP5_RAT9.905e-1535.92Aquaporin-5 OS=Rattus norvegicus GN=Aqp5 PE=2 SV=1[more]
AQP2_BOVIN1.294e-1434.31Aquaporin-2 OS=Bos taurus GN=AQP2 PE=2 SV=2[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00446 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00446 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623355 ID=BQ623355|Name=BQ623355|organism=Citrus sinensis|type=EST|length=619bp
TTTGGGAGCCATATGTGGCTGCGGGCTCGTTAAGGCTTTCCAGAAGTCTT
ACTACACGAGATACGGCGGTGGAGCCAATGAGCTCGCTGATGGGTACAGC
ACTGGCACTGGATTGGGTGCTGAGATCATCGGTACCTTTGTTCTTGTCTA
CACTGTTTTCTCCGCCACTGATCCCAAGAGAAATGCTAGGGACTCCCACG
TTCCCGTCTTGGCGCCATTGCCAATTGGATTTGCTGTGTTCATGGTTCAC
TTGGCTACGATCCCTGTCACTGGAACTGGCATCAACCCCGCTAGAAGTTT
GGGAGCTGCAGTGATTTACAGCAAGGAGAAGGCTTGGGATGATCAATGGA
TCTTCTGGGTTGGCCCCTTCATTGGTGCTGCAATTGCTGCATTTTACCAC
CAATTCATCCTCAGAGCATCTGCTTCTAAAGCTCTTGGATCCTTCAAAAG
CTCCTCCAACATTTAATTAACTTTTAAAATAATTACTGGAGGATTAATCA
ATGGCTGTCAAGCGGCTTCGCGACTATGGAATTTGTACATTGTTTTATTT
GCATCAGTATTTAGTATAGCTGGTGTAGATCCCGCAGCACTTTGTGTGTG
TCTTTTGTTTACCTGAGGA
back to top