BQ623355

Overview
NameBQ623355
Unique NameBQ623355
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length619
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4610 contig Csv1_Contig4610:525..1143. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQY2_YEAST (Aquaporin-2 OS=Saccharomyces cerevisiae GN=AQY2 PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.690e-14
Identity = 46/104 (44.23%), Postives = 57/104 (54.81%), Query Frame = 2
Query:   77 NELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIA 388
            N L  G S   GL  E+ GT VL  TV      KR         +A LPIG ++FM H+A    TGTG+NPARSLGAAV       +   WI+W+GP +GA +A
Sbjct:  165 NALGLGCSRSRGLFLEMFGTAVLCLTVLMTAVEKRETN-----FMAALPIGISLFMAHMALTGYTGTGVNPARSLGAAVAARYFPHY--HWIYWIGPLLGAFLA 261          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: TIP1_MEDTR (Probable aquaporin TIP-type OS=Medicago truncatula GN=AQP1 PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.207e-14
Identity = 50/146 (34.25%), Postives = 74/146 (50.68%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFS-ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASASKAL 436
            LG+I    L+     S    +G     L++G   G  L  EI+ TF LVYTV++ A DPK+     ++ ++AP+ IGF V    L     TG  +NPA S G AV+     +W + W++W GP IG  IA   ++ +   S  + L
Sbjct:  112 LGSIVASALLVFVTASSVPAFG-----LSEGVGVGPALVLEIVMTFGLVYTVYATAVDPKKG----NIGIIAPIAIGFIVGANILVGGAFTGASMNPAVSFGPAVV---SWSWSNHWVYWAGPLIGGGIAGLVYEVLFINSTHEQL 245          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: TIP13_ARATH (Aquaporin TIP1-3 OS=Arabidopsis thaliana GN=TIP1-3 PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.207e-14
Identity = 54/141 (38.30%), Postives = 72/141 (51.06%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFS-ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAS 421
            LGA+  C L+K       T     A  L+ G +    +  EI+ TF LVYTV++ A DPK+      + ++APL IG  V    L      G  +NPA S G AV+      W + W++WVGPFIGAAIAA  +  I   S
Sbjct:  112 LGAVVACLLLKVSTGGMET----AAFSLSYGVTPWNAVVFEIVMTFGLVYTVYATAVDPKKG----DIGIIAPLAIGLIVGANILVGGAFDGASMNPAVSFGPAVV---SWIWTNHWVYWVGPFIGAAIAAIVYDTIFIGS 241          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQPZ_GLOVI (Aquaporin Z OS=Gloeobacter violaceus GN=aqpZ PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.207e-14
Identity = 51/144 (35.42%), Postives = 80/144 (55.56%), Query Frame = 2
Query:    2 LGAICGCGLVK--AFQKSYYTRYGGGANE-----LADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAA-FYHQFI 409
            LG I G G++   A  K+ ++  GG A+         GY+    L  E++ TF+ +  +  +TD  R A        AP+ IG ++ ++HL +IPVT T +NPARS G A ++  + A  + W+FW+ P +GAA+A  FYH F+
Sbjct:   92 LGGIAGAGVLYLIAGGKAGFSLSGGFASNGYGLHSPGGYTLLACLVCEVVMTFMFLMIILGSTD--RRAPKG----FAPIAIGLSLTLIHLISIPVTNTSVNPARSTGPA-LFVGDWAIAELWLFWLAPIVGAALAGLFYHAFL 228          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP5_HUMAN (Aquaporin-5 OS=Homo sapiens GN=AQP5 PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 3.764e-14
Identity = 49/138 (35.51%), Postives = 74/138 (53.62%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAP-LPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL 412
            +GAI G G++         R     N L +  + G  +  E+I TF L   +F++TD +R +     PV +P L IG +V + HL  I  TG  +NPARS G AV+ ++       W+FWVGP +GA +AA  + ++L
Sbjct:   96 VGAIAGAGILYGVAP-LNARGNLAVNALNNNTTQGQAMVVELILTFQLALCIFASTDSRRTS-----PVGSPALSIGLSVTLGHLVGIYFTGCSMNPARSFGPAVVMNRFS--PAHWVFWVGPIVGAVLAAILYFYLL 225          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP2_RAT (Aquaporin-2 OS=Rattus norvegicus GN=Aqp2 PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 3.764e-14
Identity = 48/141 (34.04%), Postives = 71/141 (50.35%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASA 424
            LGA+ G  ++         R     N L +  + G  +  E+  T  LV  +F++TD +R            L IGF+V + HL  I  TG  +NPARSL  AV+  K   +DD W+FW+GP +GA I +  + ++L  SA
Sbjct:   95 LGAVAGAAILHEITP-VEIRGDLAVNALHNNATAGQAVTVELFLTMQLVLCIFASTDERRGDNLGS----PALSIGFSVTLGHLLGIYFTGCSMNPARSLAPAVVTGK---FDDHWVFWIGPLVGAIIGSLLYNYLLFPSA 227          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: TIP1_MEDSA (Probable aquaporin TIP-type OS=Medicago sativa GN=MCP1 PE=2 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 4.916e-14
Identity = 44/119 (36.97%), Postives = 65/119 (54.62%), Query Frame = 2
Query:   83 LADGYSTGTGLGAEIIGTFVLVYTVFS-ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASASKAL 436
            L++G   G  L  EI+ TF LVYTV++ A DPK+     ++ ++AP+ IGF V    L     TG  +NPA S G AV+     +W + W++W GP IG  IA   ++ +   S  + L
Sbjct:  133 LSEGVGVGPALVLEIVMTFGLVYTVYATAVDPKKG----NIGIIAPIAIGFIVGANILVGGAFTGASMNPAVSFGPAVV---SWSWSNHWVYWAGPLIGGGIAGLVYEVLFINSTHEQL 244          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: TIP12_MAIZE (Aquaporin TIP1-2 OS=Zea mays GN=TIP1-2 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 4.916e-14
Identity = 53/140 (37.86%), Postives = 73/140 (52.14%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGG---GANELADGYSTGTGLGAEIIGTFVLVYTVFS-ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFI 409
            LG++  C L+K          GG   GA  L+ G      +  E++ TF LVYTV++ A DPK+      + V+AP+ IGF V    LA     G  +NPA S G AV+      W++ W++WVGP  GAAIAA  +  I
Sbjct:  112 LGSVVACLLLKIAT-------GGAALGAFSLSAGVGAMNAVVLEMVMTFGLVYTVYATAVDPKKG----DLGVIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPAVVTG---VWENHWVYWVGPLAGAAIAALVYDII 237          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQY1_YEAST (Aquaporin-1 OS=Saccharomyces cerevisiae GN=AQY1 PE=1 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 4.916e-14
Identity = 44/105 (41.90%), Postives = 58/105 (55.24%), Query Frame = 2
Query:   74 ANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIA 388
            AN L  G S   GL  E+ GT +L  TV      KR         +A LPIG ++F+ H+A    TGTG+NPARSLGAAV       +   WI+W+GP +G+ +A
Sbjct:  165 ANSLGLGCSRTRGLFLEMFGTAILCLTVLMTAVEKRETN-----FMAALPIGISLFIAHVALTAYTGTGVNPARSLGAAVAARYFPHY--HWIYWIGPLLGSILA 262          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP_CICVR (Aquaporin AQPcic OS=Cicadella viridis GN=AQP PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 4.916e-14
Identity = 46/139 (33.09%), Postives = 71/139 (51.08%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRA 418
            +GAI G  ++K    + + R       LA G +   G   E   TFVL+  V S  D +R     ++   AP+ +G A+   HLA I  TG+ +NPARS G AV  + +  W + W++W GP +G  +A   ++ + RA
Sbjct:  112 VGAIAGSAILKVITPAEF-RGTLCMTSLAPGVTPPMGFLVEACITFVLILLVQSVCDDRRK----NLGNAAPVAVGLAITCCHLAAIKYTGSSMNPARSFGPAV--NGDDNWANHWVYWAGPIVGGVVAGITYRALFRA 243          
The following BLAST results are available for this feature:
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 134
Match NameE-valueIdentityDescription
AQY2_YEAST1.690e-1444.23Aquaporin-2 OS=Saccharomyces cerevisiae GN=AQY2 PE... [more]
TIP1_MEDTR2.207e-1434.25Probable aquaporin TIP-type OS=Medicago truncatula... [more]
TIP13_ARATH2.207e-1438.30Aquaporin TIP1-3 OS=Arabidopsis thaliana GN=TIP1-3... [more]
AQPZ_GLOVI2.207e-1435.42Aquaporin Z OS=Gloeobacter violaceus GN=aqpZ PE=3 ... [more]
AQP5_HUMAN3.764e-1435.51Aquaporin-5 OS=Homo sapiens GN=AQP5 PE=1 SV=1[more]
AQP2_RAT3.764e-1434.04Aquaporin-2 OS=Rattus norvegicus GN=Aqp2 PE=1 SV=1[more]
TIP1_MEDSA4.916e-1436.97Probable aquaporin TIP-type OS=Medicago sativa GN=... [more]
TIP12_MAIZE4.916e-1437.86Aquaporin TIP1-2 OS=Zea mays GN=TIP1-2 PE=2 SV=1[more]
AQY1_YEAST4.916e-1441.90Aquaporin-1 OS=Saccharomyces cerevisiae GN=AQY1 PE... [more]
AQP_CICVR4.916e-1433.09Aquaporin AQPcic OS=Cicadella viridis GN=AQP PE=1 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00446 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00446 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623355 ID=BQ623355|Name=BQ623355|organism=Citrus sinensis|type=EST|length=619bp
TTTGGGAGCCATATGTGGCTGCGGGCTCGTTAAGGCTTTCCAGAAGTCTT
ACTACACGAGATACGGCGGTGGAGCCAATGAGCTCGCTGATGGGTACAGC
ACTGGCACTGGATTGGGTGCTGAGATCATCGGTACCTTTGTTCTTGTCTA
CACTGTTTTCTCCGCCACTGATCCCAAGAGAAATGCTAGGGACTCCCACG
TTCCCGTCTTGGCGCCATTGCCAATTGGATTTGCTGTGTTCATGGTTCAC
TTGGCTACGATCCCTGTCACTGGAACTGGCATCAACCCCGCTAGAAGTTT
GGGAGCTGCAGTGATTTACAGCAAGGAGAAGGCTTGGGATGATCAATGGA
TCTTCTGGGTTGGCCCCTTCATTGGTGCTGCAATTGCTGCATTTTACCAC
CAATTCATCCTCAGAGCATCTGCTTCTAAAGCTCTTGGATCCTTCAAAAG
CTCCTCCAACATTTAATTAACTTTTAAAATAATTACTGGAGGATTAATCA
ATGGCTGTCAAGCGGCTTCGCGACTATGGAATTTGTACATTGTTTTATTT
GCATCAGTATTTAGTATAGCTGGTGTAGATCCCGCAGCACTTTGTGTGTG
TCTTTTGTTTACCTGAGGA
back to top