BQ623355

Overview
NameBQ623355
Unique NameBQ623355
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length619
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4610 contig Csv1_Contig4610:525..1143. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: TIP41_ARATH (Aquaporin TIP4-1 OS=Arabidopsis thaliana GN=TIP4-1 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 6.420e-14
Identity = 49/127 (38.58%), Postives = 68/127 (53.54%), Query Frame = 2
Query:   38 FQKSYYTR-YGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSA-TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL 412
            F  SY T   G   + LA G S   G+  EII TF L++TV++   DPK+ + D   P+L     GF V    LA    +G  +NPARS G A++      W D W++WVGP IG  +A F ++ +L
Sbjct:  113 FLLSYLTGGMGTPVHTLASGVSYTQGIIWEIILTFSLLFTVYATIVDPKKGSLDGFGPLLT----GFVVGANILAGGAFSGASMNPARSFGPALVSGN---WTDHWVYWVGPLIGGGLAGFIYENVL 232          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP2_MOUSE (Aquaporin-2 OS=Mus musculus GN=Aqp2 PE=2 SV=2)

HSP 1 Score: 77.411 bits (189), Expect = 6.420e-14
Identity = 46/137 (33.58%), Postives = 70/137 (51.09%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL 412
            LGA+ G  ++         R     N L +  + G  +  E+  T  LV  +F++TD +R+           L IGF+V + HL  I  TG  +NPARSL  AV+  K   +DD W+FW+GP +GA I +  + ++L
Sbjct:   95 LGAVAGAAILHEITP-VEIRGDLAVNALHNNATAGQAVTVELFLTMQLVLCIFASTDERRSDNLGS----PALSIGFSVTLGHLLGIYFTGCSMNPARSLAPAVVTGK---FDDHWVFWIGPLVGAVIGSLLYNYLL 223          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: TIP_ANTMA (Probable aquaporin TIP-type OS=Antirrhinum majus GN=DIP PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.095e-13
Identity = 52/134 (38.81%), Postives = 69/134 (51.49%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFS-ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYH 400
            LG+   C L+K           G    +A G     G+  EII TF LVYTV++ A DPK+ +    + V+AP+ IGF V    LA  P +G  +NPARS G AV       +   WI+W GP IG A+A F +
Sbjct:  110 LGSTVACLLLKFVTNGLSVPTHG----VAAGMDAIQGVVMEIIITFALVYTVYATAADPKKGS----LGVIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVASGD---FSQNWIYWAGPLIGGALAGFIY 232          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQPZ_CHRVO (Aquaporin Z OS=Chromobacterium violaceum GN=aqpZ PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.430e-13
Identity = 46/133 (34.59%), Postives = 65/133 (48.87%), Query Frame = 2
Query:   17 GCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQ--WIFWVGPFIGAAIAAFYHQFI 409
            G  + K F  + Y  +  G      GYS    L  E++ T   +  +  ATD +  A        APL IG A+ ++HL +IPVT T +NPARS G A+       W  Q  W+FW+ P IGA + A  ++ I
Sbjct:  107 GFDVAKGFASNGYAEHSPG------GYSLLAALVCEVVMTMFFLLVIMGATDKRAPAG------FAPLAIGLALTLIHLISIPVTNTSVNPARSTGVALFVG---GWAVQQLWLFWLAPIIGAVLGAKVYRLI 224          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: TIP31_MAIZE (Aquaporin TIP3-1 OS=Zea mays GN=TIP3-1 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.868e-13
Identity = 42/122 (34.43%), Postives = 68/122 (55.74%), Query Frame = 2
Query:   92 GYSTGTGLG------AEIIGTFVLVYTVFSAT-DPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASASKAL 436
            G++  +G+G       E + TF L+Y  ++   DPKR     HV  +APL +GF +    LA  P  G G+NPAR  G A++  +   W   W++W+GPF+GA +A   +++++  SA  A+
Sbjct:  136 GFALASGVGDWHAVLLEAVMTFGLMYAYYATVIDPKRG----HVGTIAPLAVGFLLGANVLAGGPFDGAGMNPARVFGPALVGWR---WRHHWVYWLGPFLGAGLAGLVYEYLVIPSADAAV 250          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQPZ_BRUAB (Aquaporin Z OS=Brucella abortus GN=aqpZ PE=3 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 2.440e-13
Identity = 50/143 (34.97%), Postives = 71/143 (49.65%), Query Frame = 2
Query:    2 LGAICGCGL--VKAFQKSYYTRYGGGANELAD----GYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL 412
            LGAI    +  V A  K  ++  G  +N   +    GYS   GL  EII T   +  +  +T     A        AP+ IGF + ++HL +IPVT T +NPARS G A +++   A    W+FWV P +GA I A   + +L
Sbjct:   90 LGAIAAAAILYVIASGKDGFSAGGLASNGYGELSPGGYSMMAGLLIEIILTAFFIIIILGSTSSLAPAG------FAPIAIGFGLTLIHLVSIPVTNTSVNPARSTGVA-LFADRAALSQLWLFWVAPLVGAVIGAIIWKGLL 225          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQPZ_BRUA2 (Aquaporin Z OS=Brucella abortus (strain 2308) GN=aqpZ PE=3 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 2.440e-13
Identity = 50/143 (34.97%), Postives = 71/143 (49.65%), Query Frame = 2
Query:    2 LGAICGCGL--VKAFQKSYYTRYGGGANELAD----GYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL 412
            LGAI    +  V A  K  ++  G  +N   +    GYS   GL  EII T   +  +  +T     A        AP+ IGF + ++HL +IPVT T +NPARS G A +++   A    W+FWV P +GA I A   + +L
Sbjct:   90 LGAIAAAAILYVIASGKDGFSAGGLASNGYGELSPGGYSMMAGLLIEIILTAFFIIIILGSTSSLAPAG------FAPIAIGFGLTLIHLVSIPVTNTSVNPARSTGVA-LFADRAALSQLWLFWVAPLVGAVIGAIIWKGLL 225          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: TIP32_MAIZE (Aquaporin TIP3-2 OS=Zea mays GN=TIP3-2 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 3.186e-13
Identity = 40/111 (36.04%), Postives = 61/111 (54.95%), Query Frame = 2
Query:   83 LADGYSTGTGLGAEIIGTFVLVYTVFSAT-DPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL 412
            LA G   G  +  E + TF  VY  ++   DPKR     H+  +APL +GF +    LA  P  G G+NPAR  G A++  +   W   W++W+GPF+GA +A   ++++L
Sbjct:  144 LASGVGDGHAVLLEAVMTFGFVYAYYATVVDPKRG----HLGTIAPLAVGFLLGANVLAGGPFDGAGMNPARVFGPALVGWR---WRHHWVYWLGPFLGAGLAGLVYEYLL 247          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: TIP2_TOBAC (Probable aquaporin TIP-type RB7-18C OS=Nicotiana tabacum PE=2 SV=2)

HSP 1 Score: 75.0998 bits (183), Expect = 3.186e-13
Identity = 50/134 (37.31%), Postives = 69/134 (51.49%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFS-ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYH 400
            LG+   C L+K           G    +A G +   G+  EII TF LVYTV++ A DPK+ +    +  +AP+ IGF V    LA  P +G  +NPARS G AV+      +   WI+W GP IG  +A F +
Sbjct:  110 LGSTVACLLLKYVTNGLAVPTHG----VAAGLNGFQGVVMEIIITFALVYTVYATAADPKKGS----LGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVAGD---FSQNWIYWAGPLIGGGLAGFIY 232          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: TIP31_ORYSJ (Probable aquaporin TIP3-1 OS=Oryza sativa subsp. japonica GN=TIP3-1 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 4.162e-13
Identity = 42/121 (34.71%), Postives = 66/121 (54.55%), Query Frame = 2
Query:   92 GYSTGTGLG------AEIIGTFVLVYTVFSAT-DPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASASKA 433
            G++  +G+G       E   TF L+Y  ++   DPKR     HV  +APL +GF +    LA  P  G G+NPAR  G A++  +   W   W++W+GPF+GA +A   +++++  SA  A
Sbjct:  137 GFALASGVGDWHAVLLEATMTFGLMYAYYATVIDPKRG----HVGTIAPLAVGFLLGANMLAGGPFDGAGMNPARVFGPALVGWR---WRHHWVYWLGPFVGAGLAGLLYEYLVIPSADAA 250          
The following BLAST results are available for this feature:
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 134
Match NameE-valueIdentityDescription
TIP41_ARATH6.420e-1438.58Aquaporin TIP4-1 OS=Arabidopsis thaliana GN=TIP4-1... [more]
AQP2_MOUSE6.420e-1433.58Aquaporin-2 OS=Mus musculus GN=Aqp2 PE=2 SV=2[more]
TIP_ANTMA1.095e-1338.81Probable aquaporin TIP-type OS=Antirrhinum majus G... [more]
AQPZ_CHRVO1.430e-1334.59Aquaporin Z OS=Chromobacterium violaceum GN=aqpZ P... [more]
TIP31_MAIZE1.868e-1334.43Aquaporin TIP3-1 OS=Zea mays GN=TIP3-1 PE=2 SV=1[more]
AQPZ_BRUAB2.440e-1334.97Aquaporin Z OS=Brucella abortus GN=aqpZ PE=3 SV=1[more]
AQPZ_BRUA22.440e-1334.97Aquaporin Z OS=Brucella abortus (strain 2308) GN=a... [more]
TIP32_MAIZE3.186e-1336.04Aquaporin TIP3-2 OS=Zea mays GN=TIP3-2 PE=2 SV=1[more]
TIP2_TOBAC3.186e-1337.31Probable aquaporin TIP-type RB7-18C OS=Nicotiana t... [more]
TIP31_ORYSJ4.162e-1334.71Probable aquaporin TIP3-1 OS=Oryza sativa subsp. j... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00446 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00446 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623355 ID=BQ623355|Name=BQ623355|organism=Citrus sinensis|type=EST|length=619bp
TTTGGGAGCCATATGTGGCTGCGGGCTCGTTAAGGCTTTCCAGAAGTCTT
ACTACACGAGATACGGCGGTGGAGCCAATGAGCTCGCTGATGGGTACAGC
ACTGGCACTGGATTGGGTGCTGAGATCATCGGTACCTTTGTTCTTGTCTA
CACTGTTTTCTCCGCCACTGATCCCAAGAGAAATGCTAGGGACTCCCACG
TTCCCGTCTTGGCGCCATTGCCAATTGGATTTGCTGTGTTCATGGTTCAC
TTGGCTACGATCCCTGTCACTGGAACTGGCATCAACCCCGCTAGAAGTTT
GGGAGCTGCAGTGATTTACAGCAAGGAGAAGGCTTGGGATGATCAATGGA
TCTTCTGGGTTGGCCCCTTCATTGGTGCTGCAATTGCTGCATTTTACCAC
CAATTCATCCTCAGAGCATCTGCTTCTAAAGCTCTTGGATCCTTCAAAAG
CTCCTCCAACATTTAATTAACTTTTAAAATAATTACTGGAGGATTAATCA
ATGGCTGTCAAGCGGCTTCGCGACTATGGAATTTGTACATTGTTTTATTT
GCATCAGTATTTAGTATAGCTGGTGTAGATCCCGCAGCACTTTGTGTGTG
TCTTTTGTTTACCTGAGGA
back to top