BQ623358

Overview
NameBQ623358
Unique NameBQ623358
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length651
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1053 contig Csv1_Contig1053:110..761. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623358 vs. ExPASy Swiss-Prot
Match: BT3L3_HUMAN (Transcription factor BTF3 homolog 3 OS=Homo sapiens GN=BTF3L3 PE=1 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 1.861e-30
Identity = 70/141 (49.65%), Postives = 95/141 (67.38%), Query Frame = 3
Query:   36 KLMKMAGAVRTGGKGSVRRKKKAVHKTTTTDDKRLQSTLKRIGVNAIPAIEEVNIFKDD-VVIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQKQAPNAGTGAPTTQEDDDDEVPEL 455
            KL K+   VR GGKG+  RKKK  H+T T DDK+LQ +LK++ VN I  IE+VN+F +   VI F NPK QAS+A NT+ ++G  + K++ ++LP +++QLG D+L +LR+LAE   KQ P  G     T  DDDD VPEL
Sbjct:   40 KLAKLQAQVRIGGKGTAHRKKKVFHRTATADDKKLQFSLKKLQVNNISGIEKVNMFTNQGTVIHFNNPKFQASLAVNTFTITGHAEAKQVTEMLPSVLSQLGADSLTSLRRLAEVLPKQ-PVDGKAPLATGGDDDDGVPEL 179          
BLAST of BQ623358 vs. ExPASy Swiss-Prot
Match: NACB_NEOFI (Nascent polypeptide-associated complex subunit beta OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=egd1 PE=3 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.430e-30
Identity = 67/130 (51.54%), Postives = 96/130 (73.85%), Query Frame = 3
Query:   72 GKGSVRRKKKAVHKTTTTDDKRLQSTLKRIGVNAIPAIEEVNIFKDDV-VIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQKQAPNAGTGAPTTQEDDDDEVPELV 458
            GKG+ RRK K VHK++  DDK+LQ+TLK++ V  I AIEEVN+FK+D  VI F  PKV AS+ +NT+ + G  + K+L +++PGI+NQLGPD+L +LRKLAE +Q     AGT     +++D+D++P+LV
Sbjct:   46 GKGTPRRKVKKVHKSSGADDKKLQTTLKKMNVQPIQAIEEVNMFKEDGNVIHFAAPKVHASVPSNTFALYGNGEEKELTELVPGILNQLGPDSLASLRKLAESYQNMQKQAGTEG--KKDEDEDDIPDLV 173          
BLAST of BQ623358 vs. ExPASy Swiss-Prot
Match: NACB_ASPCL (Nascent polypeptide-associated complex subunit beta OS=Aspergillus clavatus GN=egd1 PE=3 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.430e-30
Identity = 72/155 (46.45%), Postives = 105/155 (67.74%), Query Frame = 3
Query:   24 MNVEKLMKMAGAVRTG---------GKGSVRRKKKAVHKTTTTDDKRLQSTLKRIGVNAIPAIEEVNIFKDDV-VIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQKQAPNAGTGAPTTQEDDDDEVPELV 458
            M+  KL +M  +VR           GKG+ RRK K VHK++  DDK+LQ+TLK++ V  I AIEEVN+FK+D  VI F  PKV AS+ +NT+ + G  + K+L +++PGI+NQLGPD+L +LRKLAE +Q     +  GA   +++D+D++P+LV
Sbjct:    1 MDQAKLARMQASVRIDKSATNPINRGKGTPRRKVKKVHKSSGADDKKLQTTLKKMNVQPIQAIEEVNMFKEDGNVIHFAAPKVHASVPSNTFALYGNGEEKELTELVPGILNQLGPDSLASLRKLAESYQNM-QKSQAGAEGKKDEDEDDIPDLV 154          
BLAST of BQ623358 vs. ExPASy Swiss-Prot
Match: NACB_ASPFU (Nascent polypeptide-associated complex subunit beta OS=Aspergillus fumigatus GN=egd1 PE=3 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 4.145e-30
Identity = 67/130 (51.54%), Postives = 96/130 (73.85%), Query Frame = 3
Query:   72 GKGSVRRKKKAVHKTTTTDDKRLQSTLKRIGVNAIPAIEEVNIFKDDV-VIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQKQAPNAGTGAPTTQEDDDDEVPELV 458
            GKG+ RRK K VHK++  DDK+LQ+TLK++ V  I AIEEVN+FK+D  VI F  PKV AS+ +NT+ + G  + K+L +++PGI+NQLGPD+L +LRKLAE +Q     A  GA   +++D+D++P+LV
Sbjct:   49 GKGTPRRKVKKVHKSSGADDKKLQTTLKKMNVQPIQAIEEVNMFKEDGNVIHFAAPKVHASVPSNTFALYGNGEEKELTELVPGILNQLGPDSLASLRKLAESYQNMQKQA--GAEGKKDEDEDDIPDLV 176          
BLAST of BQ623358 vs. ExPASy Swiss-Prot
Match: NACB_MAGGR (Nascent polypeptide-associated complex subunit beta OS=Magnaporthe grisea GN=EGD1 PE=3 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 1.206e-29
Identity = 69/143 (48.25%), Postives = 95/143 (66.43%), Query Frame = 3
Query:   33 EKLMKMAGAVRTGGKGSVRRKKKAVHKTTTTDDKRLQSTLKRIGVNAIPAIEEVNIFKDDV-VIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQKQAPNAGTGAPTTQEDDDDEVPELV 458
            E+L K+  + R GGKG+ RRK K     +  DDK+LQ TLK++ V  I AIEEVN+FK D  VI F  PKV A++ ANT+ + G  + K+L +++PGI+NQLGPD+L +LRKLAE +Q      G      +E DDD++P+LV
Sbjct:    6 ERLKKLGASARIGGKGTPRRKMKRAPARSGGDDKKLQQTLKKLNVQPIQAIEEVNMFKSDGNVIHFAAPKVHAAVPANTFAIYGNGEDKELTELVPGILNQLGPDSLASLRKLAESYQNMQKADG-----DKEADDDDIPDLV 143          
BLAST of BQ623358 vs. ExPASy Swiss-Prot
Match: NACB_CRYNE (Nascent polypeptide-associated complex subunit beta OS=Cryptococcus neoformans GN=EGD1 PE=3 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 6.618e-28
Identity = 74/160 (46.25%), Postives = 106/160 (66.25%), Query Frame = 3
Query:   24 MNVEKLMKMAGAVRTGGKGSVRRKKKAVHKTTTT---DDKRLQSTLKRIGVNAIPAIEEVNIFKDDV-VIQFLNPKVQ--ASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQK--------QAPNAGTGAPTTQE-DDDDEVPELV 458
            M+ EKL K+   VR GGKG+ RRK   V K+ T+   DD++LQ+ LK++GV  I  +EEVN+FK+D  V+ F  P+VQ  A++ +NT  + G  QTK+L +++PGI+NQLGPD+L NLR+LAE +Q          A + G GA   +E + DDE+P+LV
Sbjct:    1 MDKEKLAKLQSQVRIGGKGTPRRK--VVKKSVTSSQGDDRKLQAALKKLGVQPITGVEEVNMFKEDGNVLHFGAPRVQVHAALPSNTLAIYGPGQTKELTELVPGILNQLGPDSLANLRRLAESYQSLTARQAAAAAGSGGEGAGEAKEGEGDDEIPDLV 158          
BLAST of BQ623358 vs. ExPASy Swiss-Prot
Match: NACB_CHAGB (Nascent polypeptide-associated complex subunit beta OS=Chaetomium globosum GN=EGD1 PE=3 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 8.643e-28
Identity = 67/144 (46.53%), Postives = 95/144 (65.97%), Query Frame = 3
Query:   33 EKLMKMAGAVRTG-GKGSVRRKKKAVHKTTTTDDKRLQSTLKRIGVNAIPAIEEVNIFKDDV-VIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQKQAPNAGTGAPTTQEDDDDEVPELV 458
            E+L K+  + R G GKG+ RRK K     +  DDK+LQ +LK++ V  I AIEEVN+FK D  VI F  PKV A++ +NT+ + G  + K+L +++PGI+NQLGPD+L +LRKLAE +Q             ++DDDDE+P+LV
Sbjct:    6 ERLKKLGASARIGTGKGTPRRKVKRAPARSGADDKKLQQSLKKLNVQPIQAIEEVNMFKSDGNVIHFAAPKVHAAVPSNTFAIYGNGEDKELTELVPGILNQLGPDSLASLRKLAESYQNM---------QQKKDDDDEIPDLV 140          
BLAST of BQ623358 vs. ExPASy Swiss-Prot
Match: NACB_NEUCR (Nascent polypeptide-associated complex subunit beta OS=Neurospora crassa GN=egd-1 PE=3 SV=2)

HSP 1 Score: 122.865 bits (307), Expect = 1.474e-27
Identity = 66/144 (45.83%), Postives = 96/144 (66.67%), Query Frame = 3
Query:   33 EKLMKMAGAVRTG-GKGSVRRKKKAVHKTTTTDDKRLQSTLKRIGVNAIPAIEEVNIFKDDV-VIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQKQAPNAGTGAPTTQEDDDDEVPELV 458
            E+L K+  + R G GKG+ RRK K     +  DDK+LQ+TLK++ V  I AIEEVN+FK D  VI F  PKV A++ ANT+ + G  + K+L +++PGI+NQLGPD+L +LRKLAE +Q    N        ++ ++D++P+LV
Sbjct:    6 ERLKKLGASARIGIGKGTPRRKVKRAPARSAGDDKKLQATLKKVNVQPIQAIEEVNMFKSDGNVIHFAAPKVHAAVPANTFAIYGNGEDKELTELVPGILNQLGPDSLASLRKLAESYQNMQKN-------EKDAEEDDIPDLV 142          
BLAST of BQ623358 vs. ExPASy Swiss-Prot
Match: NACB_USTMA (Nascent polypeptide-associated complex subunit beta OS=Ustilago maydis GN=EGD1 PE=3 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.248e-26
Identity = 66/147 (44.90%), Postives = 94/147 (63.95%), Query Frame = 3
Query:   24 MNVEKLMKMAGAVRTGGKGSVRRKKKAVHKTTTTDDKRLQSTLKRIGVNAIPAIEEVNIFKDDV-VIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQ-KQAPNAGTGAPTTQEDDDDEVPELV 458
            +N EKL K+  A RTGGKG+ RRK     K    +D +LQ+ LK++ V  +  +EEVN+FK+D  V+ F  PKV     +NT+ V G    K+L +++PGI+NQLGPD+L +LRKLAE +Q   A +A + A      DDD+VP++V
Sbjct:    3 LNQEKLAKLQAASRTGGKGTPRRKMAPKPKGPGGEDPKLQAALKKLQVEPVSGVEEVNMFKEDGNVLHFAAPKVHGLPTSNTFAVYGNGVDKELTELVPGILNQLGPDSLASLRKLAESYQAMNAQHAASQAAAAGTKDDDDVPDVV 149          
BLAST of BQ623358 vs. ExPASy Swiss-Prot
Match: NACB_GIBZE (Nascent polypeptide-associated complex subunit beta OS=Gibberella zeae GN=EGD1 PE=3 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 8.090e-26
Identity = 67/153 (43.79%), Postives = 92/153 (60.13%), Query Frame = 3
Query:   33 EKLMKMAGAVRTG----------GKGSVRRKKKAVHKTTTTDDKRLQSTLKRIGVNAIPAIEEVNIFKDDV-VIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQKQAPNAGTGAPTTQEDDDDEVPELV 458
            E+L K+    RTG          GKG+ RRK K     +  DDK+LQ  LK++    I AIEEVN+FK D  VI F  PKV A++ +NT+ + G  + K+L +++PGI+NQLGPD+L +LRKLAE +Q      G        +DDDE+P+LV
Sbjct:    6 ERLKKLGLGARTGRTSQLTEQLSGKGTPRRKVKRAPARSGADDKKLQLALKKLNTQPIQAIEEVNMFKQDGNVIHFAAPKVHAAVPSNTFAIYGNGEDKELTELVPGILNQLGPDSLASLRKLAESYQNLQKEKG--------EDDDEIPDLV 150          
The following BLAST results are available for this feature:
BLAST of BQ623358 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 43
Match NameE-valueIdentityDescription
BT3L3_HUMAN1.861e-3049.65Transcription factor BTF3 homolog 3 OS=Homo sapien... [more]
NACB_NEOFI2.430e-3051.54Nascent polypeptide-associated complex subunit bet... [more]
NACB_ASPCL2.430e-3046.45Nascent polypeptide-associated complex subunit bet... [more]
NACB_ASPFU4.145e-3051.54Nascent polypeptide-associated complex subunit bet... [more]
NACB_MAGGR1.206e-2948.25Nascent polypeptide-associated complex subunit bet... [more]
NACB_CRYNE6.618e-2846.25Nascent polypeptide-associated complex subunit bet... [more]
NACB_CHAGB8.643e-2846.53Nascent polypeptide-associated complex subunit bet... [more]
NACB_NEUCR1.474e-2745.83Nascent polypeptide-associated complex subunit bet... [more]
NACB_USTMA1.248e-2644.90Nascent polypeptide-associated complex subunit bet... [more]
NACB_GIBZE8.090e-2643.79Nascent polypeptide-associated complex subunit bet... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00449 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00449 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623358 ID=BQ623358|Name=BQ623358|organism=Citrus sinensis|type=EST|length=651bp
CACACAAAAACCCTAGCTCCAAGATGAATGTGGAGAAGCTAATGAAGATG
GCCGGTGCAGTTCGCACCGGTGGTAAGGGTAGTGTGAGAAGAAAGAAGAA
GGCTGTTCATAAGACAACAACCACCGATGACAAGAGGCTTCAGAGCACCT
TGAAGAGAATAGGAGTGAATGCTATTCCTGCAATTGAGGAAGTTAACATT
TTCAAGGATGACGTCGTTATTCAGTTCTTAAATCCCAAAGTACAAGCTTC
AATTGCTGCCAACACATGGGTAGTTAGTGGTGCCCCACAAACCAAGAAGT
TGCAGGATATTCTCCCTGGAATTATCAATCAATTGGGGCCAGATAATTTG
GACAACCTGAGGAAGTTGGCGGAGCAGTTTCAGAAGCAAGCACCTAATGC
AGGAACTGGTGCACCCACGACTCAAGAGGACGACGACGATGAGGTCCCAG
AGCTTGTGGCAGGCGAGACGTTTGAAGCTGCCGCAGAGGAGAAAACAGAG
AAACCTGACGCTGCTTCTTAGAGAGTTTTATCTAGAGGGACTTTGGGTAT
TCTATATATTTTCTATGTTTTTTGAGTTTTTATTTTACTTTTCCGAGTCA
ACTTTCTCTTGTTTTATCTGATTCTCCCTGTGACACTAGATATTGGTACT
T
back to top