BQ623442
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of BQ623442 vs. ExPASy Swiss-Prot
Match: RBS_SYNP2 (Ribulose bisphosphate carboxylase small chain OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=cbbS PE=3 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 4.516e-12 Identity = 25/55 (45.45%), Postives = 39/55 (70.91%), Query Frame = 3 Query: 129 YWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 293 +WT+WKLP++ + A +VL EV E + EY ++R++GFDN +Q Q +SF+ KP Sbjct: 52 HWTLWKLPLFNASSAQEVLNEVRECRSEYSDCYIRVVGFDNIKQCQTVSFIVYKP 106 HSP 2 Score: 25.0238 bits (53), Expect = 4.516e-12 Identity = 11/43 (25.58%), Postives = 22/43 (51.16%), Query Frame = 2 Query: 2 EALLKEISYLLRSGWIPCLEFELEKGWVYL*APQLTRILRWTL 130 + + +++ Y++ G+IP +EFE + P+L W L Sbjct: 22 QQIARQVQYMMDQGYIPGIEFEKDP------TPELHHWTLWKL 58
BLAST of BQ623442 vs. ExPASy Swiss-Prot
Match: RBS_SYNP6 (Ribulose bisphosphate carboxylase small chain OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=cbbS PE=1 SV=3) HSP 1 Score: 69.3218 bits (168), Expect = 8.198e-12 Identity = 30/65 (46.15%), Postives = 42/65 (64.62%), Query Frame = 3 Query: 99 HSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 293 HS+P + YWTMWKLP++ C QVL EV E + EY ++R+ GFDN +Q Q +SF+ +P Sbjct: 47 HSNPEEF---YWTMWKLPLFDCKSPQQVLDEVRECRSEYGDCYIRVAGFDNIKQCQTVSFIVHRP 108 The following BLAST results are available for this feature:
BLAST of BQ623442 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 112
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >BQ623442 ID=BQ623442; Name=BQ623442; organism=Citrus sinensis; type=EST; length=449bpback to top |