BQ623594

Overview
NameBQ623594
Unique NameBQ623594
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length427
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2221 contig Csv1_Contig2221:826..1252. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: SRF6_ARATH (Protein STRUBBELIG-RECEPTOR FAMILY 6 OS=Arabidopsis thaliana GN=SRF6 PE=1 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 2.982e-23
Identity = 62/141 (43.97%), Postives = 85/141 (60.28%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSE-DKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQYEADF 425
            I+ ++IKS+N+L+  +    ++D  L++  P     L+ T      GY APE +M+GQ + KSD+YSFGVV+LELLTGRKP D T  R +QSLV WATP+L + D + + VD  L G YP            LCVQ E +F
Sbjct:  540 IVDKNIKSANILLDSELNPHLSDSGLASFLPTANELLNQTDE----GYSAPEVSMSGQYSLKSDIYSFGVVMLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEPEF 676          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: TMK1_ARATH (Probable receptor protein kinase TMK1 OS=Arabidopsis thaliana GN=TMK1 PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 6.644e-23
Identity = 52/95 (54.74%), Postives = 68/95 (71.58%), Query Frame = 3
Query:    9 IHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTW 293
            IHRD+K SN+L+ DD  AK+ADF L   AP+    +  TR+ GTFGY APEYA+TG++  K DVYSFGV+L+EL+TGRK +D + P     LV+W
Sbjct:  714 IHRDLKPSNILLGDDMRAKVADFGLVRLAPEGKGSIE-TRIAGTFGYLAPEYAVTGRVTTKVDVYSFGVILMELITGRKSLDESQPEESIHLVSW 807          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: HERK_ARATH (Receptor-like protein kinase HERK 1 OS=Arabidopsis thaliana GN=HERK1 PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 6.644e-23
Identity = 55/120 (45.83%), Postives = 75/120 (62.50%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPP 365
            +IHRD+KS+N+L+ ++ +AK+ADF LS   P++     ST V G+FGY  PEY    QL  KSDVYSFGVVL E+L  R  +D TLPR   +L  WA     + ++ Q +D  L G+  P
Sbjct:  605 VIHRDVKSANILLDENFMAKVADFGLSKTGPELDQTHVSTAVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPVIDPTLPREMVNLAEWAMKWQKKGQLDQIIDQSLRGNIRP 724          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y1357_ARATH (Probable receptor-like protein kinase At1g30570 OS=Arabidopsis thaliana GN=At1g30570 PE=1 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 1.480e-22
Identity = 54/120 (45.00%), Postives = 74/120 (61.67%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPP 365
            IIHRD+K++N+L+ ++ VAK++DF LS   P M     ST V G+FGY  PEY    QL  KSDVYSFGVVL E +  R  ++ TLP+ Q +L  WA     +  +   +D+ L G+Y P
Sbjct:  640 IIHRDVKTTNILLDENFVAKMSDFGLSKAGPSMDHTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEAVCARAVINPTLPKDQINLAEWALSWQKQRNLESIIDSNLRGNYSP 759          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y5707_ARATH (Probable receptor-like protein kinase At5g47070 OS=Arabidopsis thaliana GN=At5g47070 PE=1 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 9.594e-22
Identity = 54/136 (39.71%), Postives = 75/136 (55.15%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATP-KLSEDKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQ 410
            +I+RD KSSNVL+ D    K++DF L+ + PD      +T  +GT GY APEY  TG L  KSDVYSFGVVL E++TGR+ ++   P  ++ L+ W         +    VD RL  +YP            LC++
Sbjct:  214 VIYRDFKSSNVLLDDQFCPKLSDFGLAREGPDGDNTHVTTARVGTHGYAAPEYVQTGHLRLKSDVYSFGVVLYEIITGRRTIERNKPVAERRLLDWVKEYPADSQRFSMIVDPRLRNNYPAAGARSLAKLADLCLK 349          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: SRF5_ARATH (Protein STRUBBELIG-RECEPTOR FAMILY 5 OS=Arabidopsis thaliana GN=SRF5 PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 1.636e-21
Identity = 61/141 (43.26%), Postives = 82/141 (58.16%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSE-DKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQYEADF 425
            ++H++IKSSN+L+  D   +++D+ LS         L +++ LG  GY+APE         KSDVYSFGVV+LELLTGR P D   PR ++SLV WATP+L + D +    D  L G YPP           LCVQ E +F
Sbjct:  528 VMHKNIKSSNILLDADLNPRLSDYGLSK------FYLRTSQNLGE-GYNAPEARDPSAYTPKSDVYSFGVVMLELLTGRVPFDGEKPRPERSLVRWATPQLHDIDALSNIADPALHGLYPPKSLSRFADIIALCVQVEPEF 661          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: THE1_ARATH (Receptor-like protein kinase THESEUS 1 OS=Arabidopsis thaliana GN=THE1 PE=1 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 2.791e-21
Identity = 54/120 (45.00%), Postives = 74/120 (61.67%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPP 365
            IIHRD+K++N+L+ ++ VAK+ADF LS   P +     ST V G+FGY  PEY    QL  KSDVYSFGVVL+E+L  R  ++  LPR Q ++  WA     +  + Q +D+ L G   P
Sbjct:  630 IIHRDVKTTNILLDENLVAKVADFGLSKTGPSLDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLMEVLCCRPALNPVLPREQVNIAEWAMAWQKKGLLDQIMDSNLTGKVNP 749          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: PSKR1_DAUCA (Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR PE=1 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 2.791e-21
Identity = 52/112 (46.43%), Postives = 69/112 (61.61%), Query Frame = 3
Query:    3 HIIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVD 338
            HI+HRDIKSSN+L+ D  VA +ADF L+         + +T ++GT GY  PEY        K DVYSFGVVLLELLTGR+P+D   PRG + L++W     +E +  +  D
Sbjct:  864 HILHRDIKSSNILLSDTFVAHLADFGLARLILPYDTHV-TTDLVGTLGYIPPEYGQASVATYKGDVYSFGVVLLELLTGRRPMDVCKPRGSRDLISWVLQMKTEKRESEIFD 974          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: SRF1_ARATH (Protein STRUBBELIG-RECEPTOR FAMILY 1 OS=Arabidopsis thaliana GN=SRF1 PE=2 SV=2)

HSP 1 Score: 100.138 bits (248), Expect = 3.646e-21
Identity = 59/140 (42.14%), Postives = 78/140 (55.71%), Query Frame = 3
Query:    9 IHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSE-DKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQYEADF 425
            IHR+ KS+N+L+ DD    ++D  L+      A    S ++L  +GY APE+   G    K DVYSFGVV+LELLTGRK  D    RG+Q LV WA P+L + D + + VD  L GDYP             CVQ E ++
Sbjct:  603 IHRNFKSANILLDDDIRVHVSDCGLAPLISSGAVSQLSGQLLAAYGYGAPEFEY-GIYTMKCDVYSFGVVMLELLTGRKSYDKKRDRGEQFLVRWAIPQLHDIDALAKMVDPSLKGDYPAKSLSHFADVISRCVQSEPEY 741          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y5597_ARATH (Probable receptor-like protein kinase At5g59700 OS=Arabidopsis thaliana GN=At5g59700 PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 4.761e-21
Identity = 52/120 (43.33%), Postives = 72/120 (60.00%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPP 365
            +IHRD+KS+N+L+ ++ +AK+ADF LS   P++     ST V G+FGY  PEY    QL  KSDVYSFGVV+ E+L  R  +D TL R   +L  WA     + ++   +D  L G   P
Sbjct:  602 VIHRDVKSANILLDENLMAKVADFGLSKTGPEIDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVMFEVLCARPVIDPTLTREMVNLAEWAMKWQKKGQLEHIIDPSLRGKIRP 721          
The following BLAST results are available for this feature:
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 246
Match NameE-valueIdentityDescription
SRF6_ARATH2.982e-2343.97Protein STRUBBELIG-RECEPTOR FAMILY 6 OS=Arabidopsi... [more]
TMK1_ARATH6.644e-2354.74Probable receptor protein kinase TMK1 OS=Arabidops... [more]
HERK_ARATH6.644e-2345.83Receptor-like protein kinase HERK 1 OS=Arabidopsis... [more]
Y1357_ARATH1.480e-2245.00Probable receptor-like protein kinase At1g30570 OS... [more]
Y5707_ARATH9.594e-2239.71Probable receptor-like protein kinase At5g47070 OS... [more]
SRF5_ARATH1.636e-2143.26Protein STRUBBELIG-RECEPTOR FAMILY 5 OS=Arabidopsi... [more]
THE1_ARATH2.791e-2145.00Receptor-like protein kinase THESEUS 1 OS=Arabidop... [more]
PSKR1_DAUCA2.791e-2146.43Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR... [more]
SRF1_ARATH3.646e-2142.14Protein STRUBBELIG-RECEPTOR FAMILY 1 OS=Arabidopsi... [more]
Y5597_ARATH4.761e-2143.33Probable receptor-like protein kinase At5g59700 OS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00685 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00685 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623594 ID=BQ623594|Name=BQ623594|organism=Citrus sinensis|type=EST|length=427bp
CTCATATTATCCATCGCGATATTAAGTCCAGCAATGTACTAATTTTTGAT
GATGATGTAGCAAAGATTGCCGACTTTGATTTATCTAATCAAGCTCCTGA
TATGGCAGCTCGCCTTCATTCTACTCGTGTTCTTGGAACTTTTGGTTATC
ATGCTCCTGAGTATGCAATGACTGGACAGTTGAATGCAAAGAGTGATGTA
TACAGCTTTGGTGTTGTTCTGCTTGAGCTTCTGACAGGTCGAAAACCTGT
CGATCATACACTACCACGTGGACAGCAGAGTCTAGTGACATGGGCCACAC
CGAAACTTAGTGAAGATAAGGTTAGGCAATGCGTTGATGCAAGACTAGGA
GGAGATTATCCTCCCAAGGCAGTTGCAAAGATGGCTGCAGTTGCTGCTCT
GTGTGTTCAGTATGAAGCTGATTTCCG
back to top